KEGG   Dictyoglomus turgidum: Dtur_1197Help
Entry
Dtur_1197         CDS       T00800                                 

Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00900  Terpenoid backbone biosynthesis
dtu01100  Metabolic pathways
dtu01110  Biosynthesis of secondary metabolites
dtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtur_1197
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Dtur_1197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh Sacchrp_dh_NADP DapB_N Epimerase
Motif
Other DBs
NCBI-GeneID: 7082673
NCBI-ProteinID: YP_002353090
UniProt: B8E2X6
Position
complement(1216670..1217809)
Genome map
AA seq 379 aa AA seqDB search
MRKRIIIFGATGSIGTQTLEIIDKNKDKFELIGVASKGNVDKLKAIAEKFKVPYVALFDN
KPFSLSYNAKTFYGKEGLEQLANLDSDLVIMSISGIEAVYPLKISIERGANIAIATKEIV
VACGDLIKKWLKKSKSKLIPIDSEHSALFQLINSFRKKNIEKIILTASGGPFWNKSREEM
EKTKLEEVLKHPTWKMGYKTTIDSANLVNKGLEVIEAHFFFNFDYNSIKVMIHPQSIVHG
MIELVDGSIIAQMAYPDMRIPIQYALFYPQRPKIKWSPFDLKNQKLEFYDVDYDKFPALQ
LAYEVGKKGGVYPAIFAISDEVLVELFIKGIINFKDIVSFIKYALESWKEFKEIENLEQI
EYIKNWIKNLIKQKVGYNL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaggataatcatatttggagcaactggctcaatagggacgcaaacccttgaa
attatagacaaaaataaagataaatttgaactcataggagtagcctcaaagggtaacgtt
gacaaattaaaagcaattgcagaaaaattcaaggtaccttatgttgccctatttgacaat
aagcctttttctttatcttataatgcaaagactttttatggtaaagaaggattagaacaa
cttgcaaacttagattcagatcttgtaataatgtctatttcaggtatagaagcagtttat
cctttgaaaatttccatagagagaggtgcaaatattgctattgctactaaggagattgtt
gtggcatgcggggatttaataaaaaagtggttaaaaaaatcaaagtcaaaacttatacct
atagacagcgagcatagtgctttatttcaattgataaactcttttaggaagaagaatatt
gaaaaaataattttaacagcatcaggaggtcctttttggaataagtcaagagaagaaatg
gaaaaaactaagttagaagaagtattgaaacatcctacctggaaaatgggatacaaaact
actattgattctgctaatttagtaaataaaggtttagaggtaattgaagctcatttcttc
tttaattttgattataactctattaaagtaatgattcatcctcaaagtattgtacatggt
atgatagagcttgtggatggctctattatagcccaaatggcatatccagacatgaggata
ccaatacagtacgccttattctatcctcaaagacccaaaataaaatggagtccttttgat
ttaaagaaccagaaacttgaattttacgatgtggattatgataagtttcccgctttacaa
ctggcttatgaagtgggtaagaaaggaggagtctatcctgctatatttgctatatctgat
gaagttttggtggaactttttataaagggtattattaattttaaagacatagtgtctttc
atcaaatatgcattagagtcctggaaagaatttaaagaaattgaaaatcttgaacaaatt
gaatacattaaaaactggatcaaaaatctaataaagcaaaaggtggggtataacctatga

DBGET integrated database retrieval system