KEGG   Dictyoglomus turgidum: Dtur_1367Help
Entry
Dtur_1367         CDS       T00800                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtur_1367
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtur_1367
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dtur_1367
Enzymes [BR:dtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dtur_1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1381696..1382736
Genome map
AA seq 346 aa AA seqDB search
MNGVIPRYRDLLPITDKTPLITLHEGNTPLIYANNLSKKYGIDIWLKYEGMNPTGSFKDR
GMVVAIAKALEEKSEMVICASTGNTAASAAAYAALTNLKAFVVLPEKAIALGKLAQAIMY
GAKIISVKGNFDDALKLVKEISQKFPITLVNSINPYRLEGQKTAAFEICDVLSRNPENLA
IPVGNAGNISAYWMGFKEYYKIGKIKQLPKMLGFQAEGAAPLVKGYPIPNPQTIATAIKI
GNPASWDKAINAVKESLGLIDTVSDEEILEAQKELASKEGIFVEPASAASWAGVKKLLRE
NRFPGKEVVCVLTGHGLKDPDIAIKQAKIDVSIEPKIEEFQKILEK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcgtaataccgagatacagagatctcctccccataaccgataaaacccctcta
ataaccctacatgaaggtaatactccactaatatatgccaacaatctctctaagaaatat
ggtatagatatatggcttaaatatgaaggtatgaatcctaccggatccttcaaagataga
ggtatggtggtagcaattgcaaaagctttagaagaaaaaagtgagatggttatatgtgct
tctacaggaaacaccgccgcctcagcagctgcatatgctgctcttacaaatctaaaagct
tttgtggtactcccagaaaaggctattgctttagggaaacttgcccaagctataatgtat
ggtgctaaaataattagtgtaaaaggaaattttgatgacgctttaaaattagtaaaagag
atctctcaaaaatttcctattaccttagtaaactctataaatccttatcgattagaagga
caaaaaacagcagcttttgagatttgtgatgttcttagtagaaatcctgaaaatcttgct
attcctgttggaaatgcgggaaatatatctgcctattggatgggctttaaagaatattat
aaaatagggaaaataaaacaacttcctaaaatgcttggatttcaagcagagggtgctgct
cctcttgtaaaagggtatcctattcctaatccacaaactatagctacagcaataaaaata
ggaaatcctgcaagttgggataaagctataaacgcagttaaagaatccttaggcctaatt
gacactgtctccgacgaagaaatattagaagctcaaaaggaattagcctcaaaagaagga
atatttgtagagccagcttctgcagcatcatgggctggggtaaaaaaacttttaagagag
aatagattcccaggtaaagaagtagtatgtgttcttactggacatggcttaaaagatcca
gatatagctataaaacaagctaagattgatgtatctatcgaacctaaaatagaagaattt
cagaagatattagaaaaatga

DBGET integrated database retrieval system