KEGG   Dictyoglomus turgidum: Dtur_1385Help
Entry
Dtur_1385         CDS       T00800                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtur_1385
   01230 Biosynthesis of amino acids
    Dtur_1385
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_1385
   00030 Pentose phosphate pathway
    Dtur_1385
   00051 Fructose and mannose metabolism
    Dtur_1385
   00052 Galactose metabolism
    Dtur_1385
  Energy metabolism
   00680 Methane metabolism
    Dtur_1385
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dtur_1385
Protein phosphatases and associated proteins [BR:dtu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dtur_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1400205..1401245
Genome map
AA seq 346 aa AA seqDB search
MSKMRIGVLTGGGDCPGLNPAIRGIVMRALDYGDEVIGLKYGWAGLIKADTMPLSLDIVE
DILEVGGTILGSSRTNPFKKEEDVQKCIENFKKLNLDALIAIGGEDTLGVASKFSKLGLP
MIGVPKTIDKDLEETDYTLGFDTAVEVVVDAIKRLRDTARSHARVIVVEIMGRHAGWLAL
YGGLAGGADYILIPEVEPNLEDLYNHIRKLYARGRNHAVVAIAEGVQLPGFTYQKGQEGM
VDAFGHIRLGGVGNVLAEEIQKNLGIETRAVILSHLQRGGSPSIRDRIMGLLLGKKAVDL
VHEGKSGLFVAVKGNDLVPVDITLIEGKTKNVDPEFYESVKTFFNK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatgcgcattggtgtactaacaggtggaggagattgtccaggattaaatcca
gctattcgtgggatcgtaatgagggcattggattacggggatgaagttataggtctaaaa
tatggatgggctggacttatcaaagcagatacgatgccattatccttggatatagtggag
gatattcttgaagttggtggaacaattcttggaagttcgagaacaaatccttttaaaaag
gaagaagacgtccaaaaatgtattgaaaactttaaaaaattaaacttagacgccttaata
gccataggtggtgaggatacccttggagttgcatcaaaatttagtaaacttggtcttccc
atgattggtgttccaaagaccattgataaggacttagaagagactgattatacccttggt
tttgatactgccgttgaggtagttgttgatgcaattaaaagacttagagatactgcaaga
tctcatgccagagttattgtggtagaaataatggggagacatgcaggatggttagccctt
tatggaggacttgcaggtggcgcagattatatcttaattcctgaagtagaaccaaatctt
gaagatctctacaaccatataagaaaactctacgccagaggaagaaatcatgcagttgta
gccattgcagagggagtacaacttccaggctttacctatcaaaaaggtcaagaaggaatg
gtcgatgcctttggtcatatccgcttaggtggtgtaggaaatgttcttgctgaagagata
cagaaaaacttaggaattgagactagagcggtaattttaagccatcttcaaaggggtgga
agtccctcaataagagatagaatcatgggacttcttcttggtaaaaaagctgtagatttg
gtacatgaaggaaaatccggactatttgtagctgtaaaaggaaatgatttagtaccagta
gatataaccctgattgaaggaaagacaaagaatgttgatccagaattttatgaaagtgta
aagacattctttaataagtaa

DBGET integrated database retrieval system