KEGG   Dictyoglomus turgidum: Dtur_1385Help
Entry
Dtur_1385         CDS       T00800                                 

Definition
(RefSeq) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_1385
   00030 Pentose phosphate pathway
    Dtur_1385
   00051 Fructose and mannose metabolism
    Dtur_1385
   00052 Galactose metabolism
    Dtur_1385
  Energy metabolism
   00680 Methane metabolism
    Dtur_1385
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dtur_1385
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Dtur_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1400205..1401245
Genome map
AA seq 346 aa AA seqDB search
MSKMRIGVLTGGGDCPGLNPAIRGIVMRALDYGDEVIGLKYGWAGLIKADTMPLSLDIVE
DILEVGGTILGSSRTNPFKKEEDVQKCIENFKKLNLDALIAIGGEDTLGVASKFSKLGLP
MIGVPKTIDKDLEETDYTLGFDTAVEVVVDAIKRLRDTARSHARVIVVEIMGRHAGWLAL
YGGLAGGADYILIPEVEPNLEDLYNHIRKLYARGRNHAVVAIAEGVQLPGFTYQKGQEGM
VDAFGHIRLGGVGNVLAEEIQKNLGIETRAVILSHLQRGGSPSIRDRIMGLLLGKKAVDL
VHEGKSGLFVAVKGNDLVPVDITLIEGKTKNVDPEFYESVKTFFNK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatgcgcattggtgtactaacaggtggaggagattgtccaggattaaatcca
gctattcgtgggatcgtaatgagggcattggattacggggatgaagttataggtctaaaa
tatggatgggctggacttatcaaagcagatacgatgccattatccttggatatagtggag
gatattcttgaagttggtggaacaattcttggaagttcgagaacaaatccttttaaaaag
gaagaagacgtccaaaaatgtattgaaaactttaaaaaattaaacttagacgccttaata
gccataggtggtgaggatacccttggagttgcatcaaaatttagtaaacttggtcttccc
atgattggtgttccaaagaccattgataaggacttagaagagactgattatacccttggt
tttgatactgccgttgaggtagttgttgatgcaattaaaagacttagagatactgcaaga
tctcatgccagagttattgtggtagaaataatggggagacatgcaggatggttagccctt
tatggaggacttgcaggtggcgcagattatatcttaattcctgaagtagaaccaaatctt
gaagatctctacaaccatataagaaaactctacgccagaggaagaaatcatgcagttgta
gccattgcagagggagtacaacttccaggctttacctatcaaaaaggtcaagaaggaatg
gtcgatgcctttggtcatatccgcttaggtggtgtaggaaatgttcttgctgaagagata
cagaaaaacttaggaattgagactagagcggtaattttaagccatcttcaaaggggtgga
agtccctcaataagagatagaatcatgggacttcttcttggtaaaaaagctgtagatttg
gtacatgaaggaaaatccggactatttgtagctgtaaaaggaaatgatttagtaccagta
gatataaccctgattgaaggaaagacaaagaatgttgatccagaattttatgaaagtgta
aagacattctttaataagtaa

DBGET integrated database retrieval system