KEGG   Dictyoglomus turgidum: Dtur_1388Help
Entry
Dtur_1388         CDS       T00800                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00010  Glycolysis / Gluconeogenesis
dtu00030  Pentose phosphate pathway
dtu00051  Fructose and mannose metabolism
dtu00052  Galactose metabolism
dtu00680  Methane metabolism
dtu01100  Metabolic pathways
dtu01110  Biosynthesis of secondary metabolites
dtu01120  Microbial metabolism in diverse environments
dtu01130  Biosynthesis of antibiotics
dtu01200  Carbon metabolism
dtu01230  Biosynthesis of amino acids
dtu03018  RNA degradation
Module
dtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_1388
   00030 Pentose phosphate pathway
    Dtur_1388
   00051 Fructose and mannose metabolism
    Dtur_1388
   00052 Galactose metabolism
    Dtur_1388
  Energy metabolism
   00680 Methane metabolism
    Dtur_1388
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dtur_1388
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dtur_1388
Protein phosphatases and associated proteins [BR:dtu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dtur_1388
Messenger RNA biogenesis [BR:dtu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dtur_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 7081738
NCBI-ProteinID: YP_002353276
UniProt: B8E0S5
Position
complement(1402359..1403318)
Genome map
AA seq 319 aa AA seqDB search
MIRRIGVLTSGGDAPGMNSAIRAIVRFGISKGIEIIGIERGYQGLIEGEFKVLSRDDVSE
IVQKGGTILRTARSDEFREEEGQKKAIENMEKHGLDALIVIGGEGSLKGAYDLFKKGINV
VGIPGSIDNDVWGTDFSIGFDTACNNVIDAINKIRDTAAAHERTFVIEVMGRECGFIAFT
SGLVSGADIILIPEVPIDFPYITEKLRERQKRKKRHNIIVVAEGVGSAYFIGKQIEDKLG
ISTRIVVLGHIQRGGSPSVFDRNMATFMGVEAIKRLLNGEGGVMIGWQKNSPVPISLEEV
SKYKKRVPPELYWEVECLW
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattagaagaattggagtgcttacaagtggtggagatgctcctggaatgaattctgct
ataagggctattgtaaggtttggaatatctaagggaatagaaattatagggatagagagg
ggatatcagggtttaattgagggggaatttaaggtattatcaagagatgatgtaagcgag
atagttcaaaaaggtggtactatcttacgtactgcaagatcggatgagtttagagaagaa
gaaggtcagaagaaagccattgaaaatatggaaaaacatggattagacgctttaatagtg
atcggaggagaaggttctcttaagggtgcctatgatctttttaaaaagggtataaatgtg
gtgggaattcctggcagtattgataatgatgtgtggggtactgatttttctataggtttt
gatactgcctgcaacaatgtaatagatgcgataaacaaaattagagatacagccgcagct
cacgaaagaacctttgttattgaggtcatgggtagagagtgtggcttcatagcctttact
tcaggacttgttagtggtgcagatataattcttattccagaagttcctattgattttcca
tatattacagaaaaactgagagaaaggcaaaaaaggaaaaagagacacaatattattgta
gtagcagaaggtgttggaagtgcctattttataggtaagcagattgaggataagcttgga
atttctacaagaatagttgttctcgggcatattcaaagagggggttcaccctcggttttt
gatagaaatatggctacctttatgggggtagaagctataaagagacttcttaatggggaa
ggcggagtaatgataggatggcaaaagaattcccctgttcctatttcccttgaagaagta
tcaaaatataagaagagagttccaccggaactttattgggaggtggaatgtttgtggtag

DBGET integrated database retrieval system