KEGG   Dictyoglomus turgidum: Dtur_1443Help
Entry
Dtur_1443         CDS       T00800                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00230  Purine metabolism
dtu01100  Metabolic pathways
Module
dtu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dtur_1443 (gmk)
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dtur_1443 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin KRTDAP RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-GeneID: 7081878
NCBI-ProteinID: YP_002353331
UniProt: B8E0Y0
Position
complement(1460662..1461294)
Genome map
AA seq 210 aa AA seqDB search
MFRGNLFVLSGPSGVGKDAILERVLRIVPNLVKSISYTTRPKRPGEEDGKNYFFVNEEKF
KEMIDKEEFLEWAVVHGYLYGTPKKMVEDYISKGVDVILKIDVQGGINVKRIFSDAKLVF
VLPPDFNELKRRLINRETEDLQDLNIRLKNAPLEISKISYYDYAVVNDNLDEAVDVVRCI
IYAERHRLCKEKVEHFLRIFGGVKDEGSKY
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggggaaatctttttgttttatcaggaccatcgggagttggaaaagacgcaatc
ttggaaagggttttaagaattgtacccaatcttgttaaatccatctcttataccacaagg
cctaaaagaccaggtgaagaagatggtaaaaactatttctttgtaaatgaagagaaattt
aaagaaatgatcgataaagaagagtttttggaatgggcagtggttcatggatatctttat
ggaactcctaaaaaaatggttgaagactatattagtaagggtgtagatgtaatattaaaa
atagatgtacagggaggaattaatgtaaagagaatttttagtgatgcaaagttagttttt
gttttgcctcctgattttaatgagctaaaaaggagacttataaatagagaaaccgaagat
ttacaagatttaaatatacgtctaaaaaatgcccctcttgaaatttctaagatttcttat
tatgattatgctgttgtaaatgataatttggatgaagcagtagatgtagtaaggtgtatt
atatatgctgaaagacatagactgtgcaaagaaaaagtagaacattttttaagaatcttt
ggaggtgtaaaagatgaaggaagtaaatattga

DBGET integrated database retrieval system