KEGG   Dictyoglomus turgidum: Dtur_1575Help
Entry
Dtur_1575         CDS       T00800                                 

Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00240  Pyrimidine metabolism
dtu00250  Alanine, aspartate and glutamate metabolism
dtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dtur_1575
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dtur_1575
Enzymes [BR:dtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dtur_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 7082010
NCBI-ProteinID: YP_002353463
UniProt: B8E2K5
Position
complement(1588395..1589330)
Genome map
AA seq 311 aa AA seqDB search
MWKRKDLIGIEELSREEIEVVIETALSMKDILKRPIKKVPTLRGRTICTLFYEPSTRTRS
SFELAAKYLSADTVSIATATSSVQKGESLLDTVKTLEAMGIDLFIIRHSASGVPSFIAKN
IKAGVINAGDGMHEHPTQALLDVFTVYEKKGKLEGLKIAIVGDIFHSRVARSNIYAWNKL
GSNVILCGPPTLIPPYIENLNVKVTYDLNEAIEDADIIYVLRLQLERQKRGLFPTLREYH
MFYGINQERIKKAKKDVLVMHPGPMNRGVEISSEVADSLISVINEQVTNGVAVRMALLYL
MLGGKSDENPV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagagaaaagatcttataggtatagaggagctttcaagggaggagattgaagta
gtaattgagactgctttaagtatgaaggatattttgaaaagacctattaaaaaagttccc
acattaaggggaagaactatatgtacccttttttatgagccaagtacgaggacaagatca
tcttttgaacttgctgccaaatatttaagtgcagatactgtgagtattgctacagccaca
agtagtgtgcagaagggagaaagtcttcttgacactgtcaaaaccttagaagctatggga
attgatttatttatcattaggcacagcgcttcgggtgtgccttcttttattgcgaagaat
ataaaggctggagttatcaatgcaggtgatggcatgcatgagcatcctacccaagctctt
ttagacgtttttacagtatacgaaaagaagggaaagcttgagggtttaaagatagccata
gtgggggacatatttcatagtagggttgcaagatctaacatctatgcttggaataagttg
ggaagcaatgtgatcctttgtggtcctcctaccttaatacctccatatatagaaaacctt
aatgttaaggttacctatgatctaaatgaggcaatagaagatgctgatataatttatgtc
ttaagactccagttagagagacaaaaaaggggactatttcctactttacgtgaataccat
atgttttatggaattaatcaagaaaggataaaaaaggcaaaaaaagatgtccttgtgatg
catcctggtcctatgaatagaggggttgagatatcttccgaagttgcagatagccttatt
tcggttataaatgaacaagttacaaatggagttgcagttagaatggctcttctttacctt
atgttaggagggaaaagtgatgaaaatcctgtttaa

DBGET integrated database retrieval system