KEGG   Dictyoglomus turgidum: Dtur_1614Help
Entry
Dtur_1614         CDS       T00800                                 

Gene name
ruvC
Definition
Holliday junction resolvase (EC:3.1.22.4)
Orthology
K01159  
crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
dtu  Dictyoglomus turgidum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dtu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1630081..1630557)
Genome map
AA seq 158 aa AA seqDB search
MVVIGFDPGTAITGYGILNKGEDGISIIEYGALTTPSGWGIGRRLNYLFDQVSSLLDLYN
PDVVVMENIFFNKNIKTAINIGQAQGVIILAAEQHQKEISILTPLEVKLSVVGYGRATKN
QIQYMVKEILKLKDIPKPDDVADALALCISYIYKQEGC
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcatagggtttgatcctggaactgcaataacaggttatggtattttaaataag
ggtgaagatggaatatcaataattgagtatggtgctttaactactccttctggttggggt
attggaaggaggttaaattatctatttgatcaagtttcctctcttttggatttatacaat
cctgatgtagtagtcatggagaatattttctttaataaaaacattaagactgctattaat
atagggcaagctcagggggttataatccttgcagcagaacagcatcaaaaagaaatatct
atattgactcctcttgaggtaaaactttctgtagttggctatggtagagccacaaaaaat
caaattcaatatatggttaaggagatattgaagttaaaggatattcctaaacctgatgat
gtggcagatgctttagctttgtgtatttcttacatttataaacaggaaggttgttaa

DBGET integrated database retrieval system