KEGG   Dictyoglomus turgidum: Dtur_1614Help
Entry
Dtur_1614         CDS       T00800                                 

Gene name
ruvC
Definition
Holliday junction resolvase (EC:3.1.22.4)
Orthology
K01159  
crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
dtu  Dictyoglomus turgidum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dtur_1614 (ruvC)
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     Dtur_1614 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1630081..1630557)
Genome map
AA seq 158 aa AA seqDB search
MVVIGFDPGTAITGYGILNKGEDGISIIEYGALTTPSGWGIGRRLNYLFDQVSSLLDLYN
PDVVVMENIFFNKNIKTAINIGQAQGVIILAAEQHQKEISILTPLEVKLSVVGYGRATKN
QIQYMVKEILKLKDIPKPDDVADALALCISYIYKQEGC
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcatagggtttgatcctggaactgcaataacaggttatggtattttaaataag
ggtgaagatggaatatcaataattgagtatggtgctttaactactccttctggttggggt
attggaaggaggttaaattatctatttgatcaagtttcctctcttttggatttatacaat
cctgatgtagtagtcatggagaatattttctttaataaaaacattaagactgctattaat
atagggcaagctcagggggttataatccttgcagcagaacagcatcaaaaagaaatatct
atattgactcctcttgaggtaaaactttctgtagttggctatggtagagccacaaaaaat
caaattcaatatatggttaaggagatattgaagttaaaggatattcctaaacctgatgat
gtggcagatgctttagctttgtgtatttcttacatttataaacaggaaggttgttaa

DBGET integrated database retrieval system