KEGG   Dictyoglomus turgidum: Dtur_1644Help
Entry
Dtur_1644         CDS       T00800                                 

Definition
ABC transporter-like protein
Orthology
K10441  
ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
dtu  Dictyoglomus turgidum
Pathway
ABC transporters
Module
Ribose transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:dtu02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1659943..1661430
Genome map
AA seq 495 aa AA seqDB search
MNQDLLLKMEKISKSFPGVKALDQVDLEVYKGEILALVGENGAGKSTLMKILTGVYQKDE
GRILFKGKEISPQNPHEAQKLGISIIYQEFNLAPNLDIATNIFLGNEPRKGKFIKIFDYK
KAYEESLKLLDLLGLNLSPDTLVKDLTVAEQQMVEIAKALAQKTELIIMDEPTSALAGRE
VKKLFEIMRRLKSENISIIFITHRLEEVFEIADRIVVLRDGKRVGELPAQRDKYDDVIRM
MVGREIRVIPKPSTKTEEPIFEVRNLSSKKIKNISFQLRKGEVLGIAGLVGAGRTEIIRA
IFGADPIISGEIYLEGKRIEIKSPKDAVQQKIGLVPEDRKLQGLILDMAVYENISLPSLI
YLFPNGIIKKKTEYDLAEYFVKKLQIKTPSIFQKVINLSGGNQQKVVLAKWLALKPKILI
LDEPTRGIDVGAKAEIHRLIGEMAQEGIGIILISSELPEILALSDRILVVSKGRITGEIS
KEEATQEKIMQYAII
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggatctcctattaaaaatggagaaaatttcaaaaagctttcctggagtaaaa
gctttggaccaagtagatttagaagtctacaagggtgaaattcttgcccttgtgggagaa
aacggagctggaaaatctacccttatgaaaattctaacaggagtttaccaaaaagacgaa
ggaagaatcctatttaaaggaaaggaaataagccctcaaaatcctcatgaagcccaaaaa
ttaggtatttctattatttatcaagaatttaatttggccccaaaccttgatattgctaca
aacatatttttaggtaatgagcccagaaagggtaaatttataaaaatttttgattataag
aaagcctacgaagaatcattaaaactcttagatttacttggcttaaatttatcaccagac
accttagtaaaagatcttactgtagccgaacaacaaatggtagaaattgcgaaggctctt
gctcaaaaaacagaacttatcataatggatgaacctacctcggctcttgccggaagagag
gttaaaaaactatttgagataatgagaaggcttaaaagtgagaatatttcaataatattt
attactcataggcttgaagaggtatttgaaattgctgacagaattgtagtattaagagat
gggaaaagagttggagaattacctgctcaaagggataagtatgatgatgtaataagaatg
atggtaggaagagagataagagtaataccaaaaccttctacaaaaacagaagaacctatc
tttgaggtaagaaatctatcttctaaaaagatcaaaaatatatctttccaacttagaaaa
ggagaagtcttagggattgcaggtctcgtaggagcaggaagaacagagattattagagcc
atatttggagctgatcctataatttctggagaaatatatctcgaaggaaaaaggattgaa
attaaatcaccaaaggatgcggtacaacaaaaaataggcttagtacctgaagatagaaag
cttcaaggacttattctggatatggcggtttatgagaatatttctttaccttctttaata
tatttattccctaatggaattataaaaaagaaaacagagtatgatcttgctgagtatttt
gttaaaaaactacaaataaaaacgccaagtattttccaaaaagttataaacctctctgga
ggaaatcagcaaaaagttgtgcttgcaaaatggcttgctttaaaacctaagattcttatt
cttgatgaacctacaaggggaatagatgtgggagcaaaagcagaaatacatagacttatt
ggagaaatggctcaagaaggaattggaattatccttatctcttcagaacttcctgaaatt
ctcgccctttctgatagaattcttgtagtatcaaagggaagaatcacaggagaaataagc
aaagaagaagcaacacaggagaaaataatgcaatatgcaataatttaa

DBGET integrated database retrieval system