KEGG   Dictyoglomus turgidum: Dtur_1647Help
Entry
Dtur_1647         CDS       T00800                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
dtu  Dictyoglomus turgidum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1662788..1663759)
Genome map
AA seq 323 aa AA seqDB search
MEIPSLKEVYKDYFPIGAAVSHLNIYTYEDLLKKHFNSLTPENQMKWEVIHPKPYVYDFG
PADEIVDFAMKNGMKVRGHTLVWHNQTPGWVYAGTKDEILARLKEHIYEVVGHYKGKVYA
WDVVNEALSDNPNEFLRKAPWYDICGEEVIEKAFIWANEADPNAKLFYNDYNLEDPIKRE
KAYQLVKRLKEKGIPIHGVGIQGHWTLAWPTPKMLEDSIKRFSELGVEVQITEFDISIYY
DRNENNNFKVPPDDRIEKQAQLYKQAFEILRKYRGVVTGVTFWGVADDYTWLYFWPVRGR
EDYPLLFDKNHNPKKAFWEIVKF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggagattccatccctgaaagaagtatataaagattactttcccattggtgcagcggtt
agccatttaaacatctatacttatgaggatcttcttaagaaacactttaatagtctaaca
cctgaaaatcaaatgaaatgggaagttattcatcctaaaccctatgtttatgattttggt
cctgccgatgagattgtagattttgccatgaaaaatggtatgaaggtaaggggacatacc
ttagtttggcataatcagactccaggatgggtttatgcaggaactaaagatgagattctt
gcaagattgaaagagcatatttatgaggtggtaggacactataaaggtaaggtttacgct
tgggatgtggttaatgaggccctatcagataaccctaatgagtttttgagaaaggctccc
tggtatgatatttgtggggaggaagttattgaaaaagcatttatttgggctaatgaagca
gatcctaatgctaaattattttataatgattataacttagaggatcccataaagagggaa
aaggcttatcaattggtaaaaaggcttaaagagaaagggatcccaattcatggtgttgga
atacagggccactggacattagcatggcctacacctaagatgcttgaagactctataaag
agattttcagagcttggtgttgaggttcagattactgaatttgatatatctatttactat
gacagaaatgaaaataataattttaaagttccacccgatgataggattgagaagcaggct
caactttataaacaagcctttgagatcttaaggaaatatagaggggtggtcactggggtt
actttttggggtgtagctgatgattatacttggctttacttctggcctgtaaggggaaga
gaagactatccattactctttgataagaatcataaccctaaaaaggctttttgggaaatt
gtgaagttttaa

DBGET integrated database retrieval system