KEGG   Dictyoglomus turgidum: Dtur_1670Help
Entry
Dtur_1670         CDS       T00800                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dtu  Dictyoglomus turgidum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dtur_1670
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dtur_1670
   00600 Sphingolipid metabolism
    Dtur_1670
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dtur_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1684495..1686675
Genome map
AA seq 726 aa AA seqDB search
MPIIYDRENNIFHLMAGDSSYIIKIFKNKYPVHLYWGKRLNHSHFSEAFITSPFGANPDP
NDKSFTFDRMLLEYPSYGNSDFRHPAFQVEQEDGSRITHLVFNNYRIYKGKPKLEGLPAT
YVEDEDEAETLELELADELINLRVILLYTVYKDYNVITRSIKFINEGNQKLKILRALSTC
VDFDHCNFDLLHLWGSWARERYVERVPLMHGIKVIESSRGESSHQHNPFIALLSKDATEK
HGDVYGFSLVYSGNFAANVEVDQFNTTRVTMGINPFEFTWILEKGESFQTPEVVMVYSSQ
GIGEMSRTYHRLYRKRLVRGVYRDKRRPILVNTWEAVYFNINEEKLLSLAKEAKELGIEL
FVLDDGWFGRRDDDTSSLGDWYVDKRKLPNGLDGLGKKLNEIGLKFGLWFEPEMVSPDSE
LYRKHPDWCIQVRGRTLSQCRNQYVLDITRKEVREEILRMMKEIIKNAPIEYIKWDMNRP
LTEVGSLALPPERQKEVFHRYVLALYEMMEELISEFPYILFEGCSGGGGRFDPGILYYMP
QIWTSDDTDAIERLKIQWGTSIVYPASTIGAHVSAVPNHQVGRITPLKTRGYVAMSGVFG
YEMDLTKLTPEEKELVKEQIEIYKRIWHIVFEGDLYRLVSPFEENSASWMFVTPDKKEAF
VIYVNMLAEPNPPFKKLKLDGLDPNKKYIIEGTDKEYYGDELMNIGINIPPMRDFDSFAF
ILKEKS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgcctataatatatgatagagaaaataatatttttcacttaatggcaggagattccagt
tatattataaaaatctttaaaaacaaatatcctgtacatctttactgggggaaaagacta
aaccattctcatttctcagaagcttttatcacctctccctttggggcaaatccagatcct
aatgacaaatccttcacttttgacagaatgctattagagtatccttcgtatggaaattct
gatttcagacatccagcctttcaagtagagcaagaagacggttcccgaataacccattta
gtttttaacaactacagaatatataaaggaaagcctaagcttgaaggtttacccgcaaca
tacgtagaagacgaagatgaggcagaaacccttgaattagaacttgcagatgaacttata
aacttaagagtcattctattatacaccgtttataaagattataacgtaattacaagaagc
attaaatttataaatgagggaaatcaaaaactaaagatattaagagctctaagtacttgt
gttgactttgatcattgtaattttgatcttcttcatctttggggatcatgggcaagggaa
agatacgtagagagagtaccattgatgcatggcataaaagtaattgaaagctcccgtgga
gaaagctctcaccaacacaacccctttatagctttactctccaaagatgctactgagaaa
catggcgatgtatatggatttagcttagtatatagtggaaactttgcagcaaacgtagag
gtggatcaatttaataccacaagagtcactatgggtattaatccctttgaatttacatgg
attcttgaaaagggtgaaagttttcaaacaccagaagtagtaatggtttattcctctcaa
ggaataggagaaatgtctagaacttatcacagattatatagaaaaagacttgtgagagga
gtttatagagataaaagaagacctattcttgtaaacacatgggaggcagtttattttaat
ataaatgaagaaaaacttctctccttagctaaagaggctaaagaacttggaattgaactt
tttgtccttgatgatggatggtttggaagaagagacgatgatacaagttctcttggagat
tggtatgtggacaaaagaaaattacctaacggacttgacggattgggcaaaaaattaaat
gagataggacttaaatttggactttggtttgagcctgaaatggtttctcctgatagcgaa
ctatatagaaaacatcctgattggtgtatacaagttaggggaagaactctctctcaatgt
agaaatcagtatgtgcttgacatcacgagaaaagaagtaagagaagaaatattaagaatg
atgaaagagattataaaaaatgcacctatagaatatatcaaatgggacatgaatagacct
ttaactgaagtaggttctcttgctctccctccagaaagacaaaaagaagtatttcataga
tatgtgttagctttatatgaaatgatggaggaacttatttcagaatttccctatatcctc
tttgagggatgctcaggaggaggaggcagatttgaccccggaattctctattatatgcct
caaatttggaccagtgatgacaccgatgctatagaaagattaaagatacaatggggaacc
agtatagtatatccagcatccaccattggagcccatgtatctgcagttcccaatcatcag
gtaggaagaataactcccttaaaaaccagaggctatgtagccatgtctggtgtatttgga
tacgaaatggatcttacaaaattaactcctgaggaaaaggaattagtaaaagaacaaata
gagatatataaaagaatatggcatattgtctttgagggtgacctctacagacttgtaagc
ccctttgaggaaaactctgcttcttggatgtttgttactcctgataaaaaagaggctttt
gtgatttatgtaaatatgttagctgaacctaatcctccttttaaaaagcttaaacttgat
ggattagatcccaacaaaaagtatataatcgagggtaccgacaaggaatactatggagat
gaacttatgaacattggtataaatatacctcctatgagagattttgattctttcgctttt
atattaaaagaaaaatcttaa

DBGET integrated database retrieval system