KEGG   Dictyoglomus turgidum: Dtur_1696Help
Entry
Dtur_1696         CDS       T00800                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
dtu  Dictyoglomus turgidum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dtu00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dtu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1711951..1713057
Genome map
AA seq 368 aa AA seqDB search
MPFVDHRNQKIRRSKEELLKHMQTFKLDLKFSVGIWYFTPGGGRFHEPYVEQKGIPERIE
MAAEMAKYGVKGIEAHYPAEVNEENLHLYKQLEKETGIRLVAVPLSLFYDKIFEFGSLSN
PYEKYRKIAYERLVNGLKLVKEANADICIIWPGIDGYTYSYGHLYYHMWDTFEELVAQAM
DEVPGVQVAIEPKPYEPAPNNIYRTTADGILAARDIEARLKNPENLKLLQEGHALVGLNP
EVGHVRMGFEDLPYAYARVAREGRLFHTHWNSQPLGNYDQDLNIGVVDWDSTEALLYTLK
MVGYQGYFGIDINPERIPVVKAIEINTKVLQIMNERIERLPHDRIIECYFDPENHRGELE
LILAENHR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtggatcaccgtaatcaaaaaattagaagatcaaaagaagaacttctcaaa
cacatgcaaacctttaagttagacttgaaattttccgtaggaatttggtactttacccct
ggtggtggtaggttccatgaaccctatgtagaacaaaaaggtatcccagaaagaatagaa
atggctgctgagatggcaaaatatggagtaaaaggaattgaagcccactatccagcagag
gtaaatgaagaaaaccttcatctttataaacagttagaaaaagagacaggaataagactt
gttgcggttccactgagcctattctatgataagatctttgaatttggctctctttctaat
ccctatgaaaagtatagaaaaatagcctatgaaaggttagtaaatggattaaaattagtg
aaagaggctaatgcagatatttgtattatttggcctggaattgacggatatacttattcc
tatgggcatctatactatcatatgtgggatacctttgaagaacttgtagcacaagccatg
gatgaggtacctggagtacaagtagctatagaaccaaaaccatatgagcctgctcctaat
aacatatatagaactactgctgatggaattttagctgcaagagacatagaggcaagatta
aagaatcctgaaaatttaaaacttttacaagaaggtcatgctcttgtaggacttaatcct
gaagtaggtcatgtaagaatgggatttgaagatcttccttatgcctacgcaagagtagcg
agagaaggaaggttattccatacccattggaatagccaacccttaggaaattatgaccaa
gatctaaatataggagtagttgactgggattccaccgaggctcttctttacaccctaaaa
atggtagggtatcaaggatactttggaatagatataaatccagagagaattcctgtggtt
aaggctattgagatcaatacgaaagttcttcaaattatgaatgaaagaattgaaagatta
cctcatgatagaatcattgaatgctactttgatccagaaaaccatagaggcgaacttgaa
ttaattcttgctgaaaatcacagataa

DBGET integrated database retrieval system