KEGG   Desulfovibrio vulgaris RCH1: Deval_0113Help
Entry
Deval_0113        CDS       T02064                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deval_0113
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_0113
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deval_0113
Enzymes [BR:dvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deval_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
146118..147362
Genome map
AA seq 414 aa AA seqDB search
MTATATTLHRPDTSTGFFGAYGGQFVPDQLKPILDDLAATFDACKDDPSFIEEFTYYLTR
YSGRATPLFLCSNLTARLGGARIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKVIAET
GAGQHGVATAATAALMGMQCTIYMGAEDMERQKLNVFRMRMMGAEVVPAMSGQRTLKEAV
DEALAAWVQDANETFYLLGSAVGPHPYPAIVRHFQSVIGREARAQILEAEGRLPDCCIAC
VGGGSNAIGLFAEFVPDTSVRLIGVEPAGRGLTYGDHAATLCLGEPGVLHGFYSYMLKDD
KGEAAAVYSISAGLDYPGVGPEHSHLKDMNRAEYVSVTDVEAVDAFFTLSRAEGIIPALE
SSHALAHAMKMAPAMPKDAIIVVNLSGRGDKDVAQIEEMVSNGLVTPPAMVRGL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctaccgccaccacccttcatcgtcccgacacctccaccggcttcttcggcgcg
tatggcgggcagttcgtgcccgaccagctcaagcccatcctcgacgacctcgctgccacc
ttcgacgcctgcaaggacgacccttcgttcatcgaagagttcacctactacctcacccgg
tattccgggcgggcgacgcctctcttcctgtgctccaatctgaccgcacggcttgggggg
gcgcgtatctatctcaagcgcgaagacctcaaccacctcggggcccacaaggtgaacaac
accatcggccagattctgcttgccaaacgcatgggcaagaagaaggtcatcgccgagacc
ggggccgggcagcatggcgttgccaccgcagccaccgcggcgctcatggggatgcagtgc
accatctacatgggggctgaggacatggagcgccagaagctcaacgtcttcaggatgcgc
atgatgggggcggaggtcgtgcccgccatgagcggtcagcgcaccctcaaggaagcggtg
gacgaggccctcgccgcatgggtgcaggacgccaacgagacgttctacctcttgggttcg
gcggtggggccgcatccataccccgccatcgtgcgtcatttccagtcggtcatcggtcgt
gaggcgcgtgcccagatacttgaggccgaaggacgcctgcccgattgctgcatcgcgtgc
gtgggtggtgggtccaacgccatcggtcttttcgcggagttcgtgccggatacgtcggtg
cgtctcatcggggtcgaacctgccggacgcggtctcacctacggcgaccatgccgcaacc
ctgtgccttggtgaacccggcgtcctgcacgggttctattcctacatgctcaaggacgac
aagggtgaggccgctgccgtgtattccatctcggcagggctggactaccccggtgtcggg
cctgaacacagccacctcaaggacatgaaccgggccgaatacgtcagtgtgacggacgtg
gaggctgttgatgccttcttcaccctgtcgcgtgccgagggcatcatccccgcgctggaa
tcgtcccatgctctcgcccatgccatgaagatggcgcctgccatgccgaaggacgccatc
atcgttgtgaatctctccgggcgcggcgacaaggacgtggcacagatagaggagatggtg
tcgaacgggcttgtgacaccccctgccatggtgcgtgggctgtaa

DBGET integrated database retrieval system