KEGG   Desulfovibrio vulgaris RCH1: Deval_0182Help
Entry
Deval_0182        CDS       T02064                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00051  Fructose and mannose metabolism
dvg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Deval_0182
Enzymes [BR:dvg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Deval_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II UPF0066
Motif
Other DBs
NCBI-ProteinID: ADP85353
JGI: Deval_0182
UniProt: A0A0E0SYL3
Position
237341..238339
Genome map
AA seq 332 aa AA seqDB search
MQPVLRPIGTVRSRLTRLDDCPKNGDEGAPEAWIDILPEFAAGLDTLEAGQELTLVTWLH
LADRDTLAVHPRGDTSRPMRGVFNTRSPARPNPLGLHDVRLLGTAPGPDGMVRLLVAPLE
ALHGTPVVDIKTSLSQRRDTGWGDGVPLREAETVRRLCHTAWQRGLLSGFNGNVSLRLGA
TCLVTCTGAAKGDLSPGDLAVVDIASGKRIAGGKPSSELAMHLEVYRRQPRAQAIVHTHP
PRLLALGLRVAPQQMLHIDVYEAQMLVSRLGSAPAHAPGTQALADAVGEAAVTREAVWME
RHGLVCWGETPMQALALGEELEHLAGIHLSVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgtattgcgtcccatcggcaccgtgcgctcgcgtctgacccgcctcgacgac
tgtcccaagaacggagacgagggggcccccgaggcatggatagacatcctgcccgaattc
gcggcggggctggatacgctggaggcagggcaggaactgaccctcgtcacgtggctgcat
ctcgccgaccgcgacacactcgcagtgcatccgcgtggcgacacgtcgcggcccatgcgc
ggggtgttcaacacccgttcgcccgcccgtccgaaccccctcggcctgcacgacgtgcgc
ctcctgggcaccgcccccgggccggacgggatggtgcgccttctggtggcaccgcttgag
gccctgcacggcactccggtggtggacatcaagaccagcctcagccagcggcgtgatacg
ggatggggcgacggcgtccctctgcgtgaggccgagacggttcgccgtctgtgtcacacg
gcgtggcaacggggtctgctttcgggcttcaacggcaacgtgagcctgcgcctaggggcg
acctgtctcgtcacctgtacgggggcggccaagggcgacctctctcccggcgacctcgcc
gtggtcgacatcgcctccggcaagcgcatcgcaggaggtaagccttcctctgaactcgcc
atgcaccttgaggtctatcgtcggcagccccgggcacaggccatcgtgcacacgcatccg
ccacgcctgctggccctcgggctgcgtgtcgccccgcagcagatgctgcacatcgacgtc
tacgaggcgcagatgctcgtatcgcgcctcgggtctgcccccgcccatgcccccggaacg
caggcactggccgatgccgtgggcgaggcggccgtcacccgcgaggcggtctggatggaa
cgccacgggctggtgtgctggggggagacgcccatgcaggcgcttgcgctgggtgaagaa
ctggaacacctcgcgggcatccatctctcggttttgtag

DBGET integrated database retrieval system