KEGG   Desulfovibrio vulgaris RCH1: Deval_0432Help
Entry
Deval_0432        CDS       T02064                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deval_0432
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_0432
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deval_0432
Enzymes [BR:dvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deval_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
543470..544243
Genome map
AA seq 257 aa AA seqDB search
MSASRLERRIREAQAAGRPALIPFLTAGFPTKERFWDELEALDAAGADIIEVGVPFSDPV
ADGPVVAAASQRALESGVTLRWIMDGLAARKGRLRAGLVLMGYLNPFMQYGFERFVSDAA
DAGVAGCIIPDLPLDEDADLRALLAARDMDLIALVGPNTGEGRMREYAAVASGYVYVVSV
MGTTGVRDGLPVEVADTLARARQCFSIPVALGFGISRPAQLEGLSHPPDAVIFGSALLRH
LDAGGDAASFMKAWAER
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtcacgtctcgaacggcgcattcgcgaggcacaggcggcggggcgtcccgcc
ctcatcccctttctgacggcgggcttcccgacgaaagaacgcttctgggatgaactcgag
gccctcgacgcggcaggggccgacatcatcgaagtgggcgtgcccttctccgaccccgtg
gcggacggcccggtggtggcggccgcctcgcagcgcgcgctggagtccggtgtgacgctg
cgctggatcatggacggactggcggcccgcaagggcaggctgcgtgcagggcttgtgctg
atggggtacctcaacccgttcatgcagtacggcttcgagcgtttcgtgagcgatgcggcg
gacgcaggcgtggcggggtgcatcatccccgacctgccactggatgaggacgccgacctg
cgggcactgcttgccgcgcgggacatggacctcatagcgctggtggggcccaacacgggc
gaagggcgtatgcgcgagtatgccgccgtcgcctcgggctacgtctatgtggtgtcggtc
atgggcaccacgggcgtgcgggacggcctgcccgtggaggtggcggacacgctggcgcgg
gcacgtcagtgcttctccatccccgtggcgctcggtttcggcatcagccgtccagcgcaa
ctggaggggctgtcacatccgcccgacgccgtcatcttcggttctgccctgttgcgtcat
ctcgacgcgggcggcgacgccgcctcgttcatgaaggcgtgggcggagagataa

DBGET integrated database retrieval system