KEGG   Desulfovibrio vulgaris RCH1: Deval_0629Help
Entry
Deval_0629        CDS       T02064                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deval_0629
   00030 Pentose phosphate pathway
    Deval_0629
   00051 Fructose and mannose metabolism
    Deval_0629
   00052 Galactose metabolism
    Deval_0629
   00500 Starch and sucrose metabolism
    Deval_0629
   00520 Amino sugar and nucleotide sugar metabolism
    Deval_0629
  Nucleotide metabolism
   00230 Purine metabolism
    Deval_0629
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Deval_0629
Enzymes [BR:dvg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Deval_0629
    5.4.2.8  phosphomannomutase
     Deval_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
763885..765246
Genome map
AA seq 453 aa AA seqDB search
MKALSAHVFRAYDIRGIVDTDFDPEWVERLGRACGTYFVSHGHGAAVVGFDCRHSSPAYH
DALVRGLLSTGVDVTSVGMVPTPVLYFAVKHLGRKAGVMITASHNPSEYNGFKVVAGEST
IHGEEIRRIWEVFERGEFASGHGIGCSHDIVPSYIEAITSDVHPARKLKVVVDGGNGAGG
ELCVEVLRRLGVEVVAQFCEPDGDFPNHHPDPVVEANMTALMERVQVERADLGIGLDGDA
DRLGAVDGMGRLLNGDELLSLYAREMLARRPGETVIADVKCSHRLFDDIEAHGGKPMMWI
TGHSVVKARMLEVGAPLAGELSGHMFFGDRWFGFDDAIYGAARLVELLAASDVPLTDLPG
WPPSHATRELHLPCPEHAKFEVVRRAQAYFRERCTINDIDGARVIFPDGWGLVRASNTQP
VLVLRFEAQTPERLAEIRAFVEEPLRRWVAELS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttatcggcccatgtgttcagggcctacgatatcagagggattgtcgacacc
gatttcgacccggaatgggtcgagagactcgggagggcctgcggaacctactttgtctcg
cacggtcacggggctgccgttgtggggttcgattgccgccacagttcgccagcctaccac
gacgcactcgtgcgcggcctgctgtcgacgggggtggatgtgaccagcgtgggcatggtg
cccaccccggtattgtatttcgccgtgaaacacctcgggcgcaaggccggggtcatgatc
acggcaagccacaatccatcggaatacaacgggttcaaggtcgtcgccggtgagtcgacc
atccacggcgaggagattcgccgcatatgggaggtcttcgagcgtggcgagttcgcttcg
gggcacggcatcgggtgttcccatgacatcgtgccctcctacatcgaagccatcacctct
gatgtgcaccccgcgcgcaagctgaaggtcgttgtcgacggaggcaacggtgctggcggc
gagctttgcgttgaagtgctgcgcaggctgggtgtggaggtcgtggcgcaattctgcgaa
cccgatggcgacttccccaaccatcaccccgaccccgtggtcgaggccaacatgaccgcg
ctcatggaacgcgtgcaggtcgaacgcgcagacctcggcatcggtctcgacggcgatgcc
gacaggcttggtgccgtagacgggatggggcggctgctgaacggtgacgaactgctttcg
ctctatgcgcgcgagatgctggcccgtagaccgggcgagacggtcatcgccgacgtcaaa
tgttcgcatcgccttttcgacgacatcgaggcgcacggcggcaagcccatgatgtggatc
acagggcactccgtggtcaaggcgcgtatgctcgaagtcggcgcaccgctggcgggtgag
ctttcggggcacatgttcttcggcgacagatggttcggcttcgacgacgccatctacggg
gctgcccgtctcgtggaactgctcgcagccagtgacgtgcccctgaccgacctgcccggc
tggccgccaagccacgcgacccgtgaattgcacctgccctgtccggagcacgccaagttc
gaagtcgtgcggagggcacaggcctatttccgtgagcgatgcaccatcaacgacatcgac
ggtgcgcgtgtgatctttcccgatggatggggccttgtgcgtgcctccaacacccagccg
gtgctcgtgttgcgtttcgaggcgcagacgccggaacgtctggccgagattcgcgccttc
gtcgaagaaccgttgcgacgctgggtcgcggaactttcatag

DBGET integrated database retrieval system