KEGG   Desulfovibrio vulgaris RCH1: Deval_0645Help
Entry
Deval_0645        CDS       T02064                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deval_0645
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deval_0645
   00630 Glyoxylate and dicarboxylate metabolism
    Deval_0645
Enzymes [BR:dvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deval_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
783326..785515
Genome map
AA seq 729 aa AA seqDB search
MTGRIREGGLAVAEPLHRCIEREILPGTGISPSIFWAGLEELVGTLGPRNRELLARRDNM
QAAIDAWHKEHQGRPHDAAAYRRFLEDIRYLLPAPQDLAVETQGVDPEVATIAGPQLVVP
VTNPRYALNAVNARWGSLYDALYGSDVIADSDGAARGAAYNPLRGAKVVAYAAAFLDRTF
PLAGARHADVVRYELTGPPVGRKLSALCADGTVTGLLHPDAFAGYTGGERPTTVLLRNNG
LHVELQFDRRHPVGAAHPAGLKDVVLESAVTTILDCEDSVATVDAEDKALAYRNLLGLFR
GDLETSFDKGGRSVFRRLAADRTYTAPGGAAYALPGRSLMLVRNVGLLMTTDAVLDAAGQ
EIPEGILDGLVTACIGLHDLRGAGRHRNSGAGSVYIVKPKLHGPEEVAFVCEQFRRIEDI
LGMARNTLKMGVMDEERRTTLNLAECIRVASQRIIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAQRWMLAYEDWNVDTGLAAGFGGKAQIGKGMWPKPDRLAEMVATKGAHPRAGANC
AWVPSPTAATLHALHYHEVDVFARQRELAGCHRASLDDLLALPLMGEARPSPAEVREELE
NNAQSILGYVVRWVEMGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGICTEDEVR
DVMLRMATVVDRQNKDEPGYRPMSADPGSSVAFRAACDLVFEGARQPNGYTEPILHARRR
EVKARSLTR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacgcatacgtgaaggcggcctcgctgtggccgaacccctgcaccgttgtatc
gaacgcgagattctgccgggcaccggcatctccccctccatcttctgggcggggctggaa
gagcttgtcggcaccctcggcccccgtaaccgcgaattgctggcccgacgggacaacatg
caggcggcgatagacgcatggcacaaggagcatcaggggcggccgcacgatgccgcagcc
tacaggcgttttctcgaagacatccgttatctgcttcccgcaccgcaggacctcgcggtt
gaaacgcagggggtcgaccccgaagtggcgaccatcgccgggccgcaacttgtcgtgccc
gtgaccaacccccgctatgccctcaatgccgtcaacgcccgctggggcagcctctacgac
gccctgtacggcagcgacgtgattgccgacagcgacggggctgcacgtggcgctgcctac
aatcccctgcggggcgcgaaggtggtggcgtatgccgccgcgttcctcgacaggacattc
ccgttggccggggcgaggcatgccgacgtggtgcgctacgagttgaccgggccaccggtg
ggtcgcaagctgtcggccctctgtgccgacggtacggtgacgggcctgctgcatcctgat
gcgttcgccggctatacggggggagagcgcccgacgacggtgctgctgcgcaacaacggg
ctgcatgtcgaattgcagttcgaccgcaggcacccggtgggggctgcccaccctgcggga
ctcaaggatgtggtgctcgagtcggcggtgaccaccatcctcgattgcgaggattccgtg
gccaccgtcgatgccgaagacaaggccctcgcctatcgcaacctgcttggactgttccgg
ggcgaccttgagacctcgttcgacaagggcgggcgcagcgtcttcaggcgtctggcagca
gacaggacgtacaccgcaccgggcggggcagcgtatgccctgccggggcgcagcctgatg
ctggtgcgtaacgtggggctgctcatgaccaccgacgccgtgctcgacgcggcagggcag
gagattcctgaaggcatcctagacgggctcgtcaccgcctgcatcgggctgcacgacctg
cgcggtgcggggcgtcatcgcaacagcggagccggcagcgtgtacatcgtcaaacccaag
ctgcatggccccgaagaggtggcgttcgtctgcgagcagttcagacgcatcgaagacatc
ctcggcatggcgcgcaataccctcaagatgggggtgatggacgaggaacggcgaaccacg
ctcaatcttgcggagtgcatacgggtggcttcgcagcgtatcatcttcatcaatactggc
ttcctcgaccgtacgggcgacgagatacacacctgcatggaggcggggcccgtcgtgcgc
aagaacgacatgaaggcccagcgctggatgctcgcctatgaggactggaacgtggacacc
gggcttgccgccggtttcggcggaaaggcccagataggcaagggcatgtggcccaagccc
gacaggctggcggagatggtcgccaccaagggggcgcacccgcgtgccggggccaactgc
gcgtgggttccctctccaacggcggcgacgctgcacgccctgcactaccatgaggtggat
gtcttcgcgcgtcagcgcgaacttgccggatgtcaccgggcgtcgctggacgaccttttg
gcattgccgctcatgggtgaggcgcgtccctcgcccgctgaagtgcgcgaagaactggag
aacaacgcccagagcatcctcggctacgtggtacggtgggtcgagatggggataggctgc
tcgaaagtgcccgatatccatgacgtgggtctcatggaagacagggccaccctgcgtatc
tccagccagcacatcgccaactggttgcgccatggcatctgcacggaggacgaggtgcgt
gacgtcatgctacggatggcgaccgtggtcgacaggcagaacaaggatgaaccgggctac
cggcccatgtctgccgaccccggttccagcgtggcgttcagggcggcatgcgacctcgtg
ttcgagggggcgcgccagcccaacgggtataccgaacccatcctccatgcccgcaggcgc
gaggtgaaggcgcgtagtctcacccggtag

DBGET integrated database retrieval system