KEGG   Desulfovibrio vulgaris RCH1: Deval_0675Help
Entry
Deval_0675        CDS       T02064                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00860  Porphyrin and chlorophyll metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deval_0675
Enzymes [BR:dvg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Deval_0675
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Deval_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ADP85839
JGI: Deval_0675
UniProt: A0A0E0T062
Position
824532..826043
Genome map
AA seq 503 aa AA seqDB search
MKVYLIGAGPGDPGLLTLKGKEILERADVVVYDFLANDAFLAYAKPDAEIIYVGKKGGDH
TLSQDGINRLIIEKAKEGKVVARLKGGDPYMFGRGGEEAEELLDAGVPFEEVPGVTSAIA
GPAYAGIPLTHRSYASSVSFITGHENPDKPDSAHNWQALAAGTSTLVFFMGMKNLPDISR
KLIAAGMSPDKPAALVRWGTTPRHRSLVATIATLPEEAVKHGFSNPSLIVVGDVVRLRDR
LNWFEHKPLLGKGVVVTRAREQASGLAAALRELGADVIQFPTIDIHPLDDYAPVHEAIRA
LDTYDWVVFTSVNGVKHFWNQLAALGLDSRALGGRKVAAIGPATADALRDKGIAPDFIPE
KYVAEGVVEGMLARGMGGKRVLLPRALEAREVLPEELRKAGATVDVLPVYVTVPSAARRD
DVLARMEAGEVHCVTFGSSSTVENFFSLVPADTVKAHPEVKLACIGPVTKKTLEGFGFTC
HIQPDDYTIPALVDELTRVLPEL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctatctcatcggtgccggcccgggcgaccccggactgctcaccctcaagggc
aaggaaatcctcgaacgtgcggacgtggtcgtctacgactttctggccaacgatgccttc
ctcgcctatgccaagcccgatgccgaaatcatctacgtgggcaagaagggcggcgaccat
accctttcgcaggacggcatcaaccgcctcatcatcgaaaaggccaaagagggcaaggtc
gtggcgcgcctcaagggtggcgacccctacatgttcgggcgtggcggtgaagaggccgaa
gaactgctcgacgcgggcgtgcccttcgaggaagtccccggcgtgaccagcgccatcgca
gggcctgcctacgctggtattccgctcacccaccgttcgtatgcctcgtcggtgtcgttc
atcaccgggcacgagaatcccgacaagcccgattcggcgcataactggcaggccctcgcc
gctggtaccagcacgctggtcttcttcatgggcatgaagaacctgcccgacatctcgcgc
aagctcatcgccgcgggcatgtcgcctgacaagcccgccgcgctggtgcgctgggggacg
accccgcgtcaccgcagcctcgtcgccaccatcgccacgttgcccgaagaggccgtgaag
catggcttcagcaatccctcgctcatcgttgtgggtgatgtggtgcgtctgcgcgaccgt
ctcaactggttcgagcacaagcccctgctgggcaagggcgtcgtggtcacgcgcgcccgt
gaacaggccagcggccttgctgcggcgttgcgtgaacttggggccgatgtcatccagttt
cccaccatcgacatccaccccctcgacgattacgccccggtgcatgaggccatccgcgcc
ctcgacacctacgactgggtggtcttcacctcggtcaacggcgtgaagcacttctggaac
cagcttgcggcgctggggctcgacagccgtgccctcggcggacgcaaggtggcagccatc
ggccccgccacggcggatgccctgcgcgacaagggcatcgcccccgacttcatccccgag
aagtacgtcgccgaaggcgtggtcgaagggatgctcgcccgcggtatgggcggcaagcgc
gtgctgctgccccgcgccctcgaagcgcgtgaggtgctgcccgaagaacttcgcaaggcc
ggtgccactgtcgacgtgctgcccgtgtacgtcaccgtgccctctgccgcacgccgtgac
gacgttctggcgcgcatggaggcgggcgaggtgcattgcgtgaccttcggttcgtcgtcc
accgtggagaacttcttctctctggtccctgccgatacggtgaaggcgcaccccgaagtg
aagcttgcctgcatcggcccggtgaccaagaagacgctggagggcttcggcttcacctgc
catatccagcccgacgactacaccatccccgcacttgtcgatgaactgacccgcgtattg
cctgaattgtaa

DBGET integrated database retrieval system