KEGG   Desulfovibrio vulgaris RCH1: Deval_0733Help
Entry
Deval_0733        CDS       T02064                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deval_0733
  Amino acid metabolism
   00340 Histidine metabolism
    Deval_0733
Enzymes [BR:dvg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Deval_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(885671..886981)
Genome map
AA seq 436 aa AA seqDB search
MPCRILTLQSEAQWPLLGDMLAGRYDPDDAVEPVVRDILAAVRSKGDEALAEYTRRFDCP
DFTPALLHVTSEEVAQAVASVPADDIAIIRQAADNIRSFHEAQKERSWFVTHDDGTILGQ
KVTPVDRAGLYVPGGKGGDTPLLSSLLMNAIPAQVAGVTSITVASPPRPDGTLNPHLLAA
AHILGITDIIRAGSAWAVAAFAFGTQTIAPVDVIAGPGNIFVTTAKRMVQGRVAIDMIAG
PSEILILADATARPDWVAADMLSQAEHDPLASSILVTTEPALAEAVTAELERQLATLPRA
DIARKALADWGAVVVVPDMDVAVAIANRVAPEHLEVLTAQPWELAGSLRHAGALFLGPYS
PEPLGDYFAGPNHVLPTMGTARFSSALSVQTFCKRTSIIAASRAFAERNADAVARLARLE
GLEAHARSAASRNSQQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccctgccgcatcctcactctccagtcagaggcgcaatggcctcttctcggcgacatg
ctcgccggacgatacgaccccgatgacgccgtcgaacccgtcgtgcgcgacattctcgcc
gccgtccgcagcaagggtgacgaagccctcgccgagtatacccgccgcttcgactgtccc
gatttcacccccgccttactgcacgtcacctcagaagaggtggcgcaggccgtggcttcc
gtccctgccgacgacatcgccatcatcaggcaggcagcggataacatccgcagcttccat
gaagcgcagaaggaacggtcgtggttcgtcacccatgatgacggcaccattctcgggcag
aaggtaaccccggtcgaccgtgccggtctttatgtgcccggcggcaaaggaggcgacacg
cccctgctgtcaagtctgctgatgaacgccatccccgctcaggtggcaggcgtcacgagc
atcaccgtagcctcgcccccgcgtcccgacggcactctcaatccgcacctgctcgccgcc
gcccacattctgggcatcaccgacatcatccgggcggggagtgcatgggccgtggcggcc
tttgccttcggcacacagaccatcgcgcccgtggatgtcatcgccggaccgggcaacatc
ttcgtcaccactgccaagcgcatggtacaaggccgcgttgccatcgacatgatagcaggc
cccagcgagattctcatcctcgccgatgcgacggcgcgccccgactgggtcgccgccgac
atgctctcgcaagccgagcacgacccgctggcctcgtccatacttgtcaccacggaacca
gcactcgccgaagccgtcactgcggaactcgaacgccagcttgccacgcttccgcgcgcc
gacatcgcccgcaaggcccttgccgactggggtgccgtggtcgtcgttccagacatggat
gtcgccgtggccatcgccaaccgcgtggccccggagcatcttgaggtgctcaccgctcag
ccctgggaacttgcggggagcctgcggcacgccggggcactctttcttggcccctattct
cccgagccactcggcgactacttcgccggccccaatcacgttctgcccaccatgggcacg
gcccgcttctcttcagcgctttcggtgcagacgttctgcaagcgcaccagcatcatcgcc
gcgtcacgtgcgttcgccgagcgtaacgccgacgcggtggcgcgccttgcgcgccttgaa
ggacttgaggcccacgcccgttcggcagcatcccgcaacagccaacagtaa

DBGET integrated database retrieval system