KEGG   Desulfovibrio vulgaris RCH1: Deval_0825Help
Entry
Deval_0825        CDS       T02064                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deval_0825
Enzymes [BR:dvg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Deval_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
990757..992985
Genome map
AA seq 742 aa AA seqDB search
MQTGKTATTEEQTAEALEELEGTLERVIFHNAENGYTVFRFQPKGKGGDAVSVVGHMVDP
QPGVGLLLRGGWVNNPKFGRQFRMETFESVLPATVEGIRHYLGSGLIKGVGETMAARIVA
RFGESTFSVLDDAPDRLIEVEGVGAKTLERIKTSWAEHRGIRDLIMFLQPHGVSTAYAVR
IYRYYGTHALTVVRENPYRLAMDIHGIGFITADGVATKLGFSKDSPLRAEAGVLYMLGRL
TEDGHVYFPFDGLVTHTGDKLDIRYDLVEDAIHSLEREERVVLEDLGEGVGVFLTRFHHY
ETKIAYYLRRVLASPKAVHFENPDAVVDKVLGKLDIALAPEQLEAVRTSTRSKVMVLTGG
PGTGKTTIINAIIRVFAEVGARILLAAPTGRAAKRMSETSGRESRTIHRLLEFSPKEDGF
ARNEDNPLACGLLVVDEASMMDTMLMYHLLKAVPLGATLLFVGDVHQLPSVGPGNVLRDV
IVSGVVPVVELREVFRQAAESEIICNAHRINQGEVPPLESSRDRLSDFYFIRQSDPAKVV
EMILELVRDHIPRRFGLHPVDDIQVLTPMHKGLAGAGNLNLRLQEALNPQTLCVQRGERQ
FRLDDKVMQIRNNYEKDVYNGDIGRICCVNAKERELTVRYDERNVIYAWEELDEIVPAYA
ISVHKSQGSEYPAVVIPVLTQHYVLLQRNLIYTGVTRGKRLVVLVGESRALAMAVKNNRM
QKRHTWLAHRLAQGLSTPGALL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccggaaagaccgccaccacggaagagcagaccgccgaagcccttgaagaactg
gagggcaccctcgagcgcgtcatcttccacaatgccgagaacggctacacggtgttccgc
ttccagcccaagggcaagggaggcgatgccgtcagcgtggtggggcacatggtcgacccg
caacccggcgtgggcttgctgctgcgtggcgggtgggtgaacaaccccaagttcggtcgt
cagttccgcatggagaccttcgagagtgttctgcccgccaccgtagagggcatccgccac
tatctcgggtcggggctgatcaagggggtgggcgagaccatggccgcgcgcatcgtcgcc
cggttcggcgagtcgaccttcagcgtgctggacgatgcgcccgaccgcctcatcgaggtc
gaaggcgtgggggccaagacgctggaacgcatcaagaccagctgggccgagcaccggggc
atccgcgacctcatcatgttcctgcaaccgcatggcgtgagcaccgcctatgccgtccgc
atctacaggtactacggcacgcatgcgctcaccgtggtacgcgagaatccgtatcgcctc
gccatggacatccacggcatcggcttcatcaccgccgacggggtggccaccaaactcggt
ttttccaaggacagccccctgcgcgccgaggcgggggtgctgtacatgctaggtcgtctg
acggaagacgggcatgtctactttcccttcgacggactggtgacgcatacgggtgataaa
ctcgacatccgttacgaccttgtcgaggacgccatccactcgcttgagcgagaggagagg
gtcgtgctcgaagaccttggcgaaggcgtaggggtcttcctcacccgtttccaccactac
gagacgaagatagcctactacctgcggcgcgtactggcttcgcccaaggccgtgcacttc
gagaatcccgacgccgtggtggacaaggtactgggcaagctcgacatcgcccttgcgccg
gaacagcttgaggcggtgcgcaccagcacccgcagcaaggtcatggtgctcaccgggggg
ccgggtacgggcaagaccaccatcatcaacgccatcatccgcgtcttcgccgaggtgggg
gcacgcatcctgcttgccgcgcccaccggacgcgccgccaagcgcatgtccgagacaagc
gggcgcgagtcgcgcaccatccaccgcctgctggagttcagccccaaagaggatggcttc
gcccgtaacgaggacaaccccctcgcctgcgggctgctggtggtggacgaagcctcgatg
atggacaccatgctcatgtaccacctgctgaaggccgtgccgctaggggcgacgctgctc
ttcgtgggtgatgtgcaccagttgccgtcggtggggccgggcaacgtgctgcgcgatgtc
atcgtctccggcgtggtgccggtggtggaattgcgcgaggtgttccgtcaggccgccgag
agcgagatcatctgcaacgcccaccgcatcaatcagggcgaggtgccgcctctcgaatca
tcgcgcgacaggctttccgacttctatttcatccggcagtccgaccccgccaaggtcgtg
gagatgatcctcgaactggtgcgcgaccacatcccccgtcgcttcgggctgcatcccgtc
gatgacatccaggtgctcacgcccatgcacaaggggcttgcgggtgcgggcaacctcaac
ctgcgcctgcaggaggccctcaacccccagaccctctgcgtgcagcggggcgagcgtcag
ttccgtctcgacgacaaggtcatgcagatacgcaacaactacgagaaggatgtctataac
ggcgacatcgggcgtatctgctgcgtcaacgccaaggagcgcgagctcaccgtccgctac
gatgaacgcaatgtcatctatgcgtgggaagagcttgacgagattgtgcccgcgtacgcc
atctcggtacacaagtcgcaggggtcggagtatcctgctgtggtcattccggtgctcacg
cagcattacgtccttctgcaacgcaatctcatctacaccggggtcacgcggggcaaacgg
cttgtggtgctcgtcggcgaatcgcgtgcgcttgccatggcggtgaagaacaaccggatg
cagaagcgtcatacatggctggcgcacaggctggcgcaggggctttccacccccggcgcg
ctcctctga

DBGET integrated database retrieval system