KEGG   Desulfovibrio vulgaris RCH1: Deval_0859Help
Entry
Deval_0859        CDS       T02064                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deval_0859
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Deval_0859
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Deval_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1023231..1024373
Genome map
AA seq 380 aa AA seqDB search
MEWTEERAAALREARCVVVKVGSAVLTTETGVNLAVIDSLAAQLSALQESGKRVVLVSSG
AVAAGRSALRDCCEIAGMPHKQAASAVGQSRLMHHYDEAFARYGHLSAQVLLTRDDLRNR
ERFLNARNTFQALLDWGVIPVVNENDTVAVQELKFGDNDCLASLLLNVVEGDLYVNLTSA
SGVYADNPQTNPEAGILPCIEDVHTLDLDVMCGGKTSVGTGGMYSKLLAASRAAQLGVPT
LILPGREPRILERAFSGEPVGTWVRPEARVVSRRKYWLAYQSEPSGTVTVDEGAARALLQ
QGGSLLPGGVCDVSGAFEPGALVRIAGPDGTVIAVGLSNYGDRDLVRIKGHRRHEVAAIL
GDAHFPEVVHRDNMLLDAVV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagtggacggaggaacgcgccgcagccctgcgcgaggcgcgttgcgtagtggtcaag
gtgggcagtgccgtgctgaccaccgaaacgggcgtcaatcttgccgtcatcgacagtctc
gccgcccagctttcggccttgcaggaatctggcaagcgggtggtgctcgtctcttcgggt
gctgtggctgccgggcgcagtgccttgcgcgactgctgcgagattgccggaatgccgcat
aagcaggcggcttcggccgtagggcaaagccgtctcatgcatcactatgacgaggcgttc
gcccgttacgggcatctctcggcgcaagtgcttctcacccgggacgacctgcggaaccgt
gagcgttttctcaacgcacgcaacacgttccaggcgcttctcgactggggggtcatcccg
gtcgtcaacgagaacgacaccgtggcggtgcaggaactcaagtttggcgacaacgactgc
cttgccagcctgctgctcaacgtcgtcgagggcgacctgtacgtcaacctcacctccgcg
tcgggtgtctatgccgacaacccgcagaccaatcccgaagccggtatcctgccgtgcatc
gaggacgtgcacacgctcgacctcgatgtgatgtgcggaggcaagacgtctgtcggtacc
ggcggcatgtactccaagctgctggctgcaagccgcgccgcacaactgggggtgccgacg
ctcattcttccggggcgtgaaccgcgcatcctcgaacgtgccttctcgggtgaacccgtg
gggacatgggtgcgccccgaggcacgagtcgtgtcgcgccgcaagtactggctggcgtac
cagtccgaaccttcggggacggtgacggtggacgagggtgcggcccgtgcgctgttgcag
caaggtggaagcctgcttccgggcggcgtctgcgatgtctccggcgcattcgaacccggg
gcgcttgtgcgtatcgccgggccggacggaaccgtcattgccgtgggtttgtcgaattac
ggcgaccgtgaccttgtgcggataaaggggcatcgacgtcacgaggtggctgccattctc
ggtgatgcccatttcccggaagtggtgcaccgcgacaacatgcttctggacgccgtggta
tag

DBGET integrated database retrieval system