KEGG   Desulfovibrio vulgaris RCH1: Deval_0954Help
Entry
Deval_0954        CDS       T02064                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00010  Glycolysis / Gluconeogenesis
dvg00052  Galactose metabolism
dvg00500  Starch and sucrose metabolism
dvg00520  Amino sugar and nucleotide sugar metabolism
dvg00521  Streptomycin biosynthesis
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01120  Microbial metabolism in diverse environments
dvg01130  Biosynthesis of antibiotics
dvg01200  Carbon metabolism
Module
dvg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dvg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deval_0954
   00052 Galactose metabolism
    Deval_0954
   00500 Starch and sucrose metabolism
    Deval_0954
   00520 Amino sugar and nucleotide sugar metabolism
    Deval_0954
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Deval_0954
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Deval_0954
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Deval_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADP86118
JGI: Deval_0954
UniProt: A0A0E0T0S6
Position
1141445..1142512
Genome map
AA seq 355 aa AA seqDB search
MMHRDTVTSFPFVATGMEKGCRILAADIGGTRSRFAYFDYAGGELGMGDVVRIPTAEATG
FDDLLGRVRAAAPGAWARLTRQTDTGNDAPDTPDASVTAFAAFAVAGPVEEGARCLPPNI
GWHIDLATTRGLPCAASLLNDFEAQGWACLLPGAQQCLQLLPGKPDATAPVAVVGAGTGL
GKCLLLPGTPHRVLPSEGGHATFAFEGRAEAEYAAFAADRLGVGRLIGDDVLSGPGLSLL
YAYHHGETLPPHEVAARLTGSDVVVEWFARFYGRTCRDWALHTLARGGVRIAGGVAAANP
MLVQHGAFAEAFFDCPTHTHLLRTIPVSLVTNADAGLWGAAIFALLHAGTRRTPR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatcgtgacacggtgacaagctttccctttgtcgcgaccggcatggagaagggc
tgccgtatccttgccgcagacatcggcgggacacgcagccgctttgcctacttcgactat
gccggaggggagcttggcatgggcgatgtcgtccgcatccccacggcggaggctaccggg
ttcgacgacctgcttggcagggtgcgcgcagccgcgcccggtgcatgggcgcgactgacg
cgacagactgacaccgggaatgatgctccggatacgcccgatgcaagcgtcaccgccttc
gccgcctttgccgtggcagggcctgtcgaggagggggcgcgttgtctgcctcccaacatc
ggttggcatatcgacctcgccaccacgcgtggtttgccgtgtgcagcgtcgctgctcaac
gatttcgaggcgcagggatgggcctgtctgctgcccggggcgcaacagtgccttcagcta
ctgcccggaaagccggacgcgacggcacctgtggctgtcgtcggggcaggcacggggctt
ggcaaatgccttctgcttccgggcacgccgcacagggtgctgccctcggagggagggcac
gccacgttcgccttcgaggggcgtgccgaggccgaatacgccgcctttgctgccgaccgc
cttggcgtgggacgactgattggcgatgacgtgctttccgggcccgggctgtctctgttg
tacgcctatcatcacggcgagacgctacccccgcacgaggtggcggcacgtctcaccgga
agtgacgtcgtcgtcgagtggttcgcgcgtttctacgggcgcacctgccgtgactgggcg
ttgcatacccttgccagaggcggtgtgcgcatcgcggggggagtggcggctgccaacccc
atgctggtgcagcatggggccttcgccgaggcgttcttcgattgccccacgcacacgcac
ctcttgcgcaccatccccgtctcactggtcaccaatgccgacgccggcctatggggggcg
gccatctttgccctgcttcatgccgggacaaggagaacgccacgatga

DBGET integrated database retrieval system