KEGG   Desulfovibrio vulgaris RCH1: Deval_1182Help
Entry
Deval_1182        CDS       T02064                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00040  Pentose and glucuronate interconversions
dvg00052  Galactose metabolism
dvg00500  Starch and sucrose metabolism
dvg00520  Amino sugar and nucleotide sugar metabolism
dvg01100  Metabolic pathways
dvg01130  Biosynthesis of antibiotics
Module
dvg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Deval_1182
   00052 Galactose metabolism
    Deval_1182
   00500 Starch and sucrose metabolism
    Deval_1182
   00520 Amino sugar and nucleotide sugar metabolism
    Deval_1182
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Deval_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADP86343
JGI: Deval_1182
UniProt: A0A0E0T1F4
Position
1379446..1380318
Genome map
AA seq 290 aa AA seqDB search
MNIRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAQKSGIGDVVFVTNRDK
KIIEDHFDYNLQLESVLERAGKTEMLRQVREVAEMVNIISVRQKKQLGLGHAVLCAREIV
RDEPFAVMVGDDLMFGMTPGIQQLIDVAVAEHLPVIGVMEVPADKVSRYGIIAGEETAPG
IYKVSRLVEKPSIAEAPSRLAIVGRYVLTPDIFDSLEKVKPGHGGEIQLTDALQNLADDR
GLLAVKIRGMRFDAGDWAEYLTANIYFALQEEGLRDDLISQLRPLLPFRC
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatacgcaaggtggtcattcctgtcgcagggtggggcactcggtcgcttccggcg
accaagaacatccccaaggagatgctcccggtctacaacaagcctgtggtacagtatgtc
gtagaagaggcgcaaaagtccggtattggcgatgtcgtcttcgtcaccaaccgggacaag
aagatcatcgaggaccacttcgactacaacctccagcttgaatccgttctcgagcgtgcc
ggcaagaccgaaatgctccggcaggtgcgcgaggtcgccgagatggtgaacatcatctcg
gtgcgccagaagaagcagcttggccttgggcatgccgttctttgcgcacgtgagatcgtc
cgggatgaaccctttgccgtcatggtgggtgacgacctgatgttcggcatgacgccgggt
atccagcaactcatcgatgtggctgtggcagagcacttgcctgtcatcggggtcatggag
gttccggccgacaaggtctcgcgttacggcatcattgcgggcgaggagacggccccgggc
atctacaaggtttcccgcctcgtcgagaagccgagcatcgctgaagcaccctcacgcctc
gccatcgtggggcgctatgtcctcacgccggatatcttcgacagccttgaaaaggtgaaa
cccggacatggtggcgagattcagctcaccgatgcgttgcagaaccttgccgatgacagg
gggctgcttgccgtcaagattcggggcatgcgtttcgacgcaggcgactgggccgaatat
ctcacggccaatatctatttcgcacttcaggaagaaggcttgcgcgacgacctcataagt
cagttgcgacctctcctgcctttccgttgttga

DBGET integrated database retrieval system