KEGG   Desulfovibrio vulgaris RCH1: Deval_1476Help
Entry
Deval_1476        CDS       T02064                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00300  Lysine biosynthesis
dvg01100  Metabolic pathways
dvg01120  Microbial metabolism in diverse environments
dvg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Deval_1476
Enzymes [BR:dvg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Deval_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 HSBP1 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ADP86631
JGI: Deval_1476
UniProt: A0A0E0T238
Position
complement(1689666..1690889)
Genome map
AA seq 407 aa AA seqDB search
MSSQLLSRLDNLRDRVIELQRNMTALPALGPESGGEGERAKADYLLSVLRDMGMPLIEEI
DAPDPRVPCGHRPNIAARIPGRTGRTLWVIGHMDVVPPGEAALWDTDPWQLKVDGDIIFG
RGVEDNQQGIVTGLLVAQELLASGTVPDMGFGLLLVADEETGNNYGMAHVATARPDLFGD
DDLVIVPDFGTEDGAMIEIAEKSMLWLKVQVAGKQCHASTPDEGINSLVAASAMILRVHE
LDARFDAVDPLFNPPASTFVPTKKEANVPNVNTVPGNDVFYIDCRVLPCYLLTDVRQAVR
EIADDIERAYGVTVTLSDVQAEQAAPATSSDSDVVHRLTRAIRAEYGVEARPMGVGGGTV
GAILRKRGLPVAVWSTLVPNPHTPNEASRISRTIGDAKVVARMLFDA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaactcctctcccgcctcgacaacctgcgtgacagggtcatcgaactccag
cgcaacatgacggccctgcccgccctcggccccgaaagcggcggcgaaggcgaacgcgcc
aaggccgactatcttctttccgtcctgcgtgacatgggaatgcccctcatcgaggagata
gacgcccccgacccgcgtgtcccctgcggtcacaggccgaacatcgcggcacgcataccc
ggccgtacggggcgcaccctgtgggtcataggccatatggatgtcgtgccccccggcgag
gcggccctgtgggataccgacccgtggcaactcaaggtcgatggcgacatcatcttcggg
cgcggcgtcgaggacaaccagcaaggcatcgtcaccggcctgctggtggcacaggaactt
cttgcctccggcacggtgcccgacatgggtttcggccttctcctcgtcgccgatgaggag
actggcaacaactacggcatggcgcatgtcgccacggcccgccccgaccttttcggcgac
gacgaccttgtcatcgtgcccgacttcggcaccgaagacggcgcgatgatcgaaatcgcg
gaaaagagcatgctctggctcaaagtgcaggttgcaggcaaacagtgccatgcgtccaca
cccgacgagggcatcaactcgctggttgccgcctctgccatgatactgcgcgtgcatgag
cttgacgcgcgtttcgatgcggtagacccgcttttcaacccgcccgcctccaccttcgtc
cccacgaagaaggaagccaacgtgcccaacgtcaacacggtccccggtaacgatgtgttc
tacatcgactgccgtgtcctgccctgctacctactcaccgatgtgcggcaggccgtacgg
gaaatcgccgacgatatcgaacgggcctacggtgtcaccgtgactctctccgatgtacag
gccgaacaggccgcgcccgcgacctcctccgacagcgacgtcgtgcatcgcctgacccgt
gccatccgtgccgaatacggcgtggaagcccgccccatgggcgtgggcggaggcacagtg
ggcgccatcctgcgcaagcggggactccctgtggccgtatggtcgacgctcgtacccaat
cctcacactcccaacgaggcttcacgcatctcgcgcaccatcggtgacgccaaggtcgtc
gcccgtatgctcttcgacgcctga

DBGET integrated database retrieval system