KEGG   Desulfovibrio vulgaris RCH1: Deval_1479Help
Entry
Deval_1479        CDS       T02064                                 

Definition
putative carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dvg  Desulfovibrio vulgaris RCH1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1692910..1693704
Genome map
AA seq 264 aa AA seqDB search
MGEVGGTGGTMTGGACLLIHGFGGAPFEMEPLAVALSEAGVEAHVITLPGHDATLEDFEA
TCFDDWARHADECYRDLEARAGRVVVVGLSMGGTLALHLGCRFRPAGVVALAAPVFLYRA
VPFVMQDWRLPFVGLLKRVRRRWPVPCRKPEATAVAPWRGYDGVMALPQLHSLIKGMGQV
ERELPLLVAPLLLMHARGDRTVPVENALHIARRVTSDDVCVRLFGLADRVAGHHLITTHR
ESRSFVAREVVSFTQRALSQNCKK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggtcgggggcactggaggaacaatgaccggaggggcatgtctgctcattcac
ggtttcggcggggcgccgttcgagatggaaccgctggccgttgcgttgtccgaggccggg
gtcgaggcacacgtcatcaccctgcccgggcatgatgcgacacttgaagatttcgaggcc
acctgtttcgacgactgggcgcgccatgccgacgagtgctaccgggaccttgaggcacgc
gctgggcgcgttgtggtcgtcggtctttccatgggcggaacgcttgccctgcacctgggc
tgccgcttccggcccgccggggttgtcgcccttgccgcgcctgtcttcctgtaccgtgcc
gtaccgttcgtcatgcaggactggcgcctacccttcgtagggttgctcaagcgggtgcgg
cgtcgatggcctgtgccgtgtcgcaagcccgaggccacagccgtggcgccgtggcgcggt
tatgacggggtcatggccttgccgcagctgcacagcctcatcaaggggatggggcaggtt
gagcgggagttgccactgctggtggccccgcttcttctgatgcacgcccgcggcgaccgt
accgtgcctgtggagaatgcccttcacatcgcccgacgcgtgacgtcggatgatgtctgt
gtacggttgttcgggctcgccgacagggtggcagggcatcatctcatcacgacccatcgc
gagagtcggagctttgtcgctcgtgaggtcgtttcgtttacgcaaagagcattgtctcaa
aattgtaaaaaatag

DBGET integrated database retrieval system