KEGG   Desulfovibrio vulgaris RCH1: Deval_1635Help
Entry
Deval_1635        CDS       T02064                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Deval_1635
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Deval_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1844957..1845382)
Genome map
AA seq 141 aa AA seqDB search
MRDIPGVRVVDVSPSYYTEPQEKRDQPWFANRVARLLCSSGVTPEGLLASLLDIEARLGR
RREADAPRFGPRVIDIDLLVFGGEQRDGDVLTLPHPRMAGRAFVLVPLRDVAPDFSFPDG
VSLHERLAALPHRVEGRRIWQ
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatatccccggagtgcgggtggtggatgtctctccgtcctactatacagaaccg
caagagaagcgtgaccagccgtggttcgccaaccgggtagcccgtttgctgtgctcgtcc
ggcgtgacaccggaaggcctgctcgcttctttgctggatatcgaagcccgtctggggcgt
cggcgtgaagccgatgccccgcgcttcgggccgcgggtcatcgatatcgacctgctcgtc
ttcggtggcgaacagcgcgatggcgatgtgctgacgctgccacaccctcgcatggcaggc
agggcgttcgttctcgtcccgcttcgcgatgtggccccggacttctccttccctgacggt
gtgtcgctgcatgaaaggctggcggcactgccccatcgcgtcgagggccgacgcatctgg
cagtaa

DBGET integrated database retrieval system