KEGG   Desulfovibrio vulgaris RCH1: Deval_1718Help
Entry
Deval_1718        CDS       T02064                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Deval_1718
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Deval_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1924001..1924861
Genome map
AA seq 286 aa AA seqDB search
MNDAVTLRSGCKVNLDLHITSRRDDGYHEIDSLFLPLEEPHDELVVTVGDAPGITVTCAI
QGIDPTRNTVTRAYDAYAEASGFRPPLRVELRKGVPHGAGLGGGSANAAAILNHLESIAP
HPLGRETLCRLAARIGADVPFFIHAVPCRASGIGEIITPVAWPYKGFTLLLACPQVQVST
AWAYGALDAAEEKQLRVRGCLTTGGVADRNSFSRESWLHNSFEPVVFASHPELRSLKEAL
LRHGAAAALMSGSGASVFALFRRREDAEAAFEQLKGHGIRVYQHLL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcggtgacgctccgttccgggtgcaaggtcaatctcgacctccatatcacg
tcgcgccgtgacgacggctatcacgaaatcgacagcctcttccttccgctggaggaaccg
cacgacgaactggtggtgacggttggcgatgctcccggaataactgtgacgtgtgccatt
cagggcatcgacccgacacggaacacggtcacccgcgcctacgacgcctatgccgaagcc
tccggattccgcccgcctcttcgcgtcgagttgcgaaaaggcgttccgcatggggcagga
ctgggaggcggcagtgccaacgccgctgcaatcctgaaccacctcgaatccatcgccccg
catcccctcggaagagagacgctatgcagactggcggcccgcatcggagccgacgtgccg
ttcttcatccatgcggtcccgtgccgtgccagcggcattggcgagatcatcacccctgtg
gcatggccgtacaagggattcaccctgcttctcgcctgcccgcaggtacaggtctccacg
gcatgggcctacggcgcgctggatgctgccgaagaaaaacaactccgcgtgcgtggttgc
ttgacaacggggggggttgcggatagaaactcgttctcccgcgagtcatggctccataac
agcttcgaaccggtggtcttcgcgtctcacccggagctgcggtcgctcaaggaagccttg
ttgcgacatggcgcggcagccgccctcatgagcggtagcggcgcgagcgtcttcgccctc
ttcaggaggcgtgaagatgccgaagcggccttcgaacagctgaagggtcatggcatacgg
gtatatcagcatcttttgtga

DBGET integrated database retrieval system