KEGG   Desulfovibrio vulgaris RCH1: Deval_1718Help
Entry
Deval_1718        CDS       T02064                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dvg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1924001..1924861
Genome map
AA seq 286 aa AA seqDB search
MNDAVTLRSGCKVNLDLHITSRRDDGYHEIDSLFLPLEEPHDELVVTVGDAPGITVTCAI
QGIDPTRNTVTRAYDAYAEASGFRPPLRVELRKGVPHGAGLGGGSANAAAILNHLESIAP
HPLGRETLCRLAARIGADVPFFIHAVPCRASGIGEIITPVAWPYKGFTLLLACPQVQVST
AWAYGALDAAEEKQLRVRGCLTTGGVADRNSFSRESWLHNSFEPVVFASHPELRSLKEAL
LRHGAAAALMSGSGASVFALFRRREDAEAAFEQLKGHGIRVYQHLL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcggtgacgctccgttccgggtgcaaggtcaatctcgacctccatatcacg
tcgcgccgtgacgacggctatcacgaaatcgacagcctcttccttccgctggaggaaccg
cacgacgaactggtggtgacggttggcgatgctcccggaataactgtgacgtgtgccatt
cagggcatcgacccgacacggaacacggtcacccgcgcctacgacgcctatgccgaagcc
tccggattccgcccgcctcttcgcgtcgagttgcgaaaaggcgttccgcatggggcagga
ctgggaggcggcagtgccaacgccgctgcaatcctgaaccacctcgaatccatcgccccg
catcccctcggaagagagacgctatgcagactggcggcccgcatcggagccgacgtgccg
ttcttcatccatgcggtcccgtgccgtgccagcggcattggcgagatcatcacccctgtg
gcatggccgtacaagggattcaccctgcttctcgcctgcccgcaggtacaggtctccacg
gcatgggcctacggcgcgctggatgctgccgaagaaaaacaactccgcgtgcgtggttgc
ttgacaacggggggggttgcggatagaaactcgttctcccgcgagtcatggctccataac
agcttcgaaccggtggtcttcgcgtctcacccggagctgcggtcgctcaaggaagccttg
ttgcgacatggcgcggcagccgccctcatgagcggtagcggcgcgagcgtcttcgccctc
ttcaggaggcgtgaagatgccgaagcggccttcgaacagctgaagggtcatggcatacgg
gtatatcagcatcttttgtga

DBGET integrated database retrieval system