KEGG   Desulfovibrio vulgaris RCH1: Deval_1913Help
Entry
Deval_1913        CDS       T02064                                 

Definition
(GenBank) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00010  Glycolysis / Gluconeogenesis
dvg00030  Pentose phosphate pathway
dvg00051  Fructose and mannose metabolism
dvg00052  Galactose metabolism
dvg00680  Methane metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01120  Microbial metabolism in diverse environments
dvg01130  Biosynthesis of antibiotics
dvg01200  Carbon metabolism
dvg01230  Biosynthesis of amino acids
dvg03018  RNA degradation
Module
dvg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deval_1913
   00030 Pentose phosphate pathway
    Deval_1913
   00051 Fructose and mannose metabolism
    Deval_1913
   00052 Galactose metabolism
    Deval_1913
  Energy metabolism
   00680 Methane metabolism
    Deval_1913
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Deval_1913
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Deval_1913
Protein phosphatases and associated proteins [BR:dvg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Deval_1913
Messenger RNA biogenesis [BR:dvg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Deval_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADP87062
JGI: Deval_1913
UniProt: A0A0E0T3E5
Position
2140407..2141741
Genome map
AA seq 444 aa AA seqDB search
MPGTRFEKDGLVIDTTIPHLGPAKIPSPLVYCHHTNDTGVPLYLDSEFIEELAGESTALN
FEAAGPRRNLYFDPSKAKCAIVTCGGLCPGINDVIRAIVMEARHAYDVPAVLGIRYGLEG
FIPKYRHDVVELTPDVVSDIHQFGGTILGSSRGPQSPEEIVDALERMNISALFMIGGDGT
LKAASNIVQEVMRRNLKISVIGVPKTIDNDINFISQSFGFETAVYKATEAIQCAHTEAIG
AMNGIGLVKLMGRESGFIAAHATLSLKEVNFVLIPEAPFTLHGEGGLLPTLERRLRARAH
AVIVVAEGAGQNLLADTGKKDASGNPILGDIAQLLRAEIKAYCDERGLPHTLKYIDPSYI
IRSVPANANDRVYCGFLGQHAVHAAMAGRTGMVVAKLMDRYVHLPLELVTLRRRKLNIRS
DYWRAVLESTGQAELAGMVPGLDE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacgcgtttcgagaaggatggccttgtcatcgacaccaccatccctcatctc
ggccccgccaagataccctcccctctggtctactgccatcacaccaacgacactggtgta
ccgctgtacctcgactccgagttcatcgaagaactggccggtgagagcactgccctcaac
ttcgaagcggccgggccgcgccgtaatctctacttcgacccgtcaaaggccaagtgcgcc
atcgtcacctgcggtggcctgtgccccggcatcaacgacgtcatccgggccatcgtcatg
gaggcccgccacgcctacgacgtgcccgccgtgctgggcatccggtacgggcttgaaggt
ttcatccccaagtaccgccatgacgtggtcgaactgacgcccgatgtcgtgtcggacatc
catcaattcggtgggaccatcctcggttcgtcacgcggcccgcagtcgccggaagagatc
gtcgacgccctcgaacgcatgaacatcagcgcactcttcatgatcggcggcgacggaacc
ctcaaggcagcctccaacatcgtgcaggaggtgatgcgccgcaatctcaagatttcggtc
atcggcgtccccaagaccatcgacaacgacatcaacttcatcagccagtcgttcggcttc
gaaacagcggtgtacaaggccaccgaagccatccagtgcgcccataccgaggccatcggc
gccatgaacggcatcggtctcgtcaaactcatggggcgcgagtcgggcttcatcgccgca
cacgccacgctttcgctcaaagaggtcaacttcgtcctcatccccgaagcccccttcacc
ctgcatggcgagggcggcctgctaccgacgctcgaacgccgtctgcgcgcccgggcccac
gccgtcatcgtggtcgccgaaggtgcggggcagaatctgctggctgacacgggcaagaag
gacgcctcgggcaaccccatcctcggcgacatagcccagctgctgcgcgccgaaatcaag
gcatactgcgacgaacgcggcctgccgcacacgctcaagtacatcgaccccagctacatc
atccgctccgtgcccgccaacgccaacgaccgcgtctactgcggcttcctcggccagcat
gcggtacacgcggccatggccggacgcaccggcatggtcgtggcgaagctcatggacagg
tacgtgcatctgccccttgaacttgtcacgctgcgcaggcgcaagctcaacatccgctcc
gactactggcgcgccgtgcttgaatcgaccggacaggccgaacttgccggcatggtgccc
ggtctcgacgaataa

DBGET integrated database retrieval system