KEGG   Desulfovibrio vulgaris RCH1: Deval_1913Help
Entry
Deval_1913        CDS       T02064                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deval_1913
   01230 Biosynthesis of amino acids
    Deval_1913
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deval_1913
   00030 Pentose phosphate pathway
    Deval_1913
   00051 Fructose and mannose metabolism
    Deval_1913
   00052 Galactose metabolism
    Deval_1913
  Energy metabolism
   00680 Methane metabolism
    Deval_1913
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Deval_1913
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Deval_1913
Protein phosphatases and associated proteins [BR:dvg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Deval_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2140407..2141741
Genome map
AA seq 444 aa AA seqDB search
MPGTRFEKDGLVIDTTIPHLGPAKIPSPLVYCHHTNDTGVPLYLDSEFIEELAGESTALN
FEAAGPRRNLYFDPSKAKCAIVTCGGLCPGINDVIRAIVMEARHAYDVPAVLGIRYGLEG
FIPKYRHDVVELTPDVVSDIHQFGGTILGSSRGPQSPEEIVDALERMNISALFMIGGDGT
LKAASNIVQEVMRRNLKISVIGVPKTIDNDINFISQSFGFETAVYKATEAIQCAHTEAIG
AMNGIGLVKLMGRESGFIAAHATLSLKEVNFVLIPEAPFTLHGEGGLLPTLERRLRARAH
AVIVVAEGAGQNLLADTGKKDASGNPILGDIAQLLRAEIKAYCDERGLPHTLKYIDPSYI
IRSVPANANDRVYCGFLGQHAVHAAMAGRTGMVVAKLMDRYVHLPLELVTLRRRKLNIRS
DYWRAVLESTGQAELAGMVPGLDE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacgcgtttcgagaaggatggccttgtcatcgacaccaccatccctcatctc
ggccccgccaagataccctcccctctggtctactgccatcacaccaacgacactggtgta
ccgctgtacctcgactccgagttcatcgaagaactggccggtgagagcactgccctcaac
ttcgaagcggccgggccgcgccgtaatctctacttcgacccgtcaaaggccaagtgcgcc
atcgtcacctgcggtggcctgtgccccggcatcaacgacgtcatccgggccatcgtcatg
gaggcccgccacgcctacgacgtgcccgccgtgctgggcatccggtacgggcttgaaggt
ttcatccccaagtaccgccatgacgtggtcgaactgacgcccgatgtcgtgtcggacatc
catcaattcggtgggaccatcctcggttcgtcacgcggcccgcagtcgccggaagagatc
gtcgacgccctcgaacgcatgaacatcagcgcactcttcatgatcggcggcgacggaacc
ctcaaggcagcctccaacatcgtgcaggaggtgatgcgccgcaatctcaagatttcggtc
atcggcgtccccaagaccatcgacaacgacatcaacttcatcagccagtcgttcggcttc
gaaacagcggtgtacaaggccaccgaagccatccagtgcgcccataccgaggccatcggc
gccatgaacggcatcggtctcgtcaaactcatggggcgcgagtcgggcttcatcgccgca
cacgccacgctttcgctcaaagaggtcaacttcgtcctcatccccgaagcccccttcacc
ctgcatggcgagggcggcctgctaccgacgctcgaacgccgtctgcgcgcccgggcccac
gccgtcatcgtggtcgccgaaggtgcggggcagaatctgctggctgacacgggcaagaag
gacgcctcgggcaaccccatcctcggcgacatagcccagctgctgcgcgccgaaatcaag
gcatactgcgacgaacgcggcctgccgcacacgctcaagtacatcgaccccagctacatc
atccgctccgtgcccgccaacgccaacgaccgcgtctactgcggcttcctcggccagcat
gcggtacacgcggccatggccggacgcaccggcatggtcgtggcgaagctcatggacagg
tacgtgcatctgccccttgaacttgtcacgctgcgcaggcgcaagctcaacatccgctcc
gactactggcgcgccgtgcttgaatcgaccggacaggccgaacttgccggcatggtgccc
ggtctcgacgaataa

DBGET integrated database retrieval system