KEGG   Desulfovibrio vulgaris RCH1: Deval_2089Help
Entry
Deval_2089        CDS       T02064                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deval_2089
Enzymes [BR:dvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Deval_2089
Exosome [BR:dvg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deval_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2340281..2342203)
Genome map
AA seq 640 aa AA seqDB search
MTIPCSRPLFIEPFDLYLFGMGRHRHLYRILGAHPAVQDGEAGYRFAVWAPNARSVHLSG
DCNGWRHEGCPLFPVGVSGVWAAFVPGVRRGSLYKFVVRGADGRQEQKADPFALWAEMRP
GVASVAWDIDNHAWGDGAWMAERARQGLPLERPVSIYEVHLGSWRRRHGDGHPFLTYDEL
GDQLIPYATGLGFTHLELLPVAEHPLDQSWGYQTGHYYAPTSRFGSPEGFKRFVDRCHQA
GLGVILDWVPAHFPRDAWSLGRFDGTALYEHLDPRLGEHPDWGTYIFNYGRNEVRNFLTA
NALYWLREFHIDGLRMDAVASMLYLDYSREAGQWLPNRHGGRENLDAVDFLREVNTVIHA
EFPGAMTLAEESTAWPGVSRPVYTGGLGFSFKWNMGWMHDTLGYLAEDPIHRAYHHGSLT
FSMLYAFSENFVLPLSHDEVVHGKGALLSKMPGDMWQQQANLRLLYAYQWAHPGKKLLFM
GGEFGQWNEWDESRELDWCLYRFPAHEGIARLVGDLNRLLRSEPAMHRRDHDWSGFRWVD
FADYGSSVISFLRLAAGERPLLWIFNFTPVVRRFYRVPCPRGGTWRELCNTDSAYYGGSD
VGNAGAVMAREDHWGGGHFIELTLPPLAAMCFAPVTGQGT
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattccgtgcagccgtcccctgttcatcgagcctttcgacctctacctcttcggc
atggggcggcacaggcacctctaccgcattctcggcgcacacccggcagtacaggatggc
gaggcgggctatcgctttgcggtgtgggcccccaatgcccgttccgtgcacctgtccggc
gactgcaacggttggcggcatgagggctgcccccttttccccgtgggggtgtcgggcgta
tgggccgccttcgtgcccggagtgcgccgcgggtcgctttacaagttcgtggtgcgcggg
gccgatggtcggcaagagcagaaggccgaccccttcgccctgtgggcggagatgcgcccc
ggggtggcgtcggtggcatgggatatcgacaaccatgcatggggcgacggggcgtggatg
gctgaacgggcgcgtcaggggctgcccctcgaacgtccggtctccatctacgaggtgcat
ctcgggtcgtggcggcgcaggcatggcgacggccatccgttcctgacctacgatgaactg
ggcgaccagctcattccctatgccacgggactgggcttcactcaccttgaactgctgccc
gtggcggaacaccccctcgaccagtcgtggggctaccagacggggcactactacgcgccg
acctcgcgtttcggttcgcccgaggggttcaaacggttcgtcgacaggtgccatcaggca
gggctaggcgtcatcctcgactgggtcccggcccatttcccgcgggacgcatggagcctt
gggcgtttcgatggtacggcgctgtatgagcacctcgacccgcgccttggcgaacacccc
gactggggaacctacatcttcaactacgggcgcaacgaggtgcgcaacttcctcaccgcc
aatgccctgtactggctgcgggagttccacatcgacggtctgcgcatggacgccgtggcg
tccatgctctacctcgactactcgcgcgaagcggggcagtggctgcccaacaggcatggc
ggacgcgagaacctcgatgccgtggacttcctgcgcgaggtcaacacggtcatccatgcc
gagtttcccggtgccatgacgctggcggaggaatccaccgcatggcccggtgtctcccgt
ccggtctacacgggcggactggggttcagcttcaagtggaacatgggctggatgcatgac
acgctgggctaccttgcagaagacccgatacaccgggcctatcaccacggttcgctgacc
ttctccatgctctacgccttcagcgagaatttcgtgctgccgctgtcacatgacgaggtc
gtgcacggcaagggggcgctgctgtcgaagatgcccggcgacatgtggcagcaacaggcc
aacctgcggttgctctacgcctaccagtgggcgcatcccggcaagaagctgctgttcatg
gggggcgaattcggccagtggaacgagtgggacgaaagccgcgaactggactggtgtctc
taccgtttccccgcccatgagggcatcgcgcggctggtgggcgacctcaaccggttgctg
cgttccgaacctgccatgcacaggcgcgaccacgactggtcgggcttccgctgggtggat
ttcgcggactacggcagttcggtgatcagtttcctccggctggccgcgggtgaacgacct
ctcctgtggattttcaacttcacgcccgtggtgcgtcgcttctaccgcgtgccctgcccg
cgtggcggcacgtggcgtgagctgtgcaacaccgacagtgcctactacggcggcagtgac
gtgggtaacgccggtgccgtcatggcacgggaagaccactggggtggcgggcacttcatc
gaactgacgctacccccgcttgccgccatgtgcttcgcccccgtgacagggcagggcacc
tag

DBGET integrated database retrieval system