KEGG   Desulfovibrio vulgaris RCH1: Deval_2152Help
Entry
Deval_2152        CDS       T02064                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00040  Pentose and glucuronate interconversions
dvg00052  Galactose metabolism
dvg00500  Starch and sucrose metabolism
dvg00520  Amino sugar and nucleotide sugar metabolism
dvg01100  Metabolic pathways
dvg01130  Biosynthesis of antibiotics
Module
dvg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Deval_2152
   00052 Galactose metabolism
    Deval_2152
   00500 Starch and sucrose metabolism
    Deval_2152
   00520 Amino sugar and nucleotide sugar metabolism
    Deval_2152
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Deval_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-ProteinID: ADP87296
JGI: Deval_2152
UniProt: A0A0E0T3Z7
Position
2420802..2422274
Genome map
AA seq 490 aa AA seqDB search
MTASTGEQSPFMESSAPMSPRPEHATHSARESFSRLMREERLPGELIDLFLGYHGEIEAS
HTGLIGENDILPAKVEDFTHLDSLTRYAPEGRKLMHRAVCIRLNGGLGTSMGMTHAKSLL
PARHDRSFLDIIHGQAEHQRKAHGGASPLLFMNSYATHADTLRALESMAAPEHMPRCFLQ
HRFPKVDRATLLPVRSHEAGDMAWNPPGHGDIYAALVLSGMLDALLSEGRRWALVANADN
LGASLDPAILGYMAAHRIPFLMECARRTPADSKGGHLARTPEGGLVLREVAQCPADDMAH
FQDIHRYGLFNTNNIWLDLAALRDRVERYGLLRLPLILNPKTLDPRDPESTPVWQVETAM
GAAIALFPGATAIVTPRRRFLPVKRCNDLLLLWSDCFSLGEDFHLNRRVAHDSPLPRIDL
DPKHYGTWDRLMQRFPHGAPAMRSCTAMQVRGDVRFGDDVALDGEVRIRNSAKAQAVIPD
GTRLSGEVHL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccaccggtgaacaaagcccatttatggaatcgagcgcccccatgtcacct
cgccccgaacatgcgacacattccgcgcgcgagtcgttcagtcgcctcatgcgtgaagag
aggctgccgggcgaactcatcgacctcttcctcggctatcatggcgaaatcgaggccagc
cataccggactcatcggtgagaatgacatcctgcccgccaaggtcgaggatttcacccat
ctcgacagcctgacccgctatgcccccgaaggccgcaagctgatgcaccgcgccgtctgc
atcaggctcaatggtggtctcggcaccagcatgggcatgacacacgccaagtcgcttctg
ccagcacgacacgacaggagttttctcgacatcatccacggacaggcagaacatcagcgc
aaggcccacggcggcgcatcgcccctgctgttcatgaacagctacgccacgcacgccgac
accctgcgtgccctcgaaagcatggcggcccccgaacacatgccgcgttgcttcctgcag
catcgtttccccaaggtcgaccgcgccacactccttcccgtacgaagccatgaagccggc
gacatggcgtggaaccctccggggcacggcgacatctacgccgccctcgtactctcgggc
atgctcgacgccctgctttccgaaggtcgccgatgggcgctggttgccaacgccgacaat
ctaggggcatcactcgacccggccattctcggctacatggcggcacatcgcatccccttt
ctcatggaatgcgcccgtcgcacccccgccgacagcaagggcgggcaccttgcccgcaca
ccggaaggcggtctcgtcctgcgcgaggtggcacagtgccctgccgacgacatggcccac
tttcaggacatccatcgctacggactcttcaataccaacaacatatggctcgacctcgcg
gcactgcgtgacagggttgaacgctacggcctgttgcggttgcccctcatcctcaatccc
aagacgctcgacccccgcgaccccgaatccactcccgtctggcaggtggaaacggccatg
ggggcggccatcgccctctttccgggtgcgacagccatcgtcaccccccgccgccgcttt
ctgccggtcaaacgctgcaacgacctgctgctactctggtcggactgcttcagcctcggc
gaggacttccacctcaatcgccgcgtggcgcatgacagccccctgccccgcatcgacctc
gaccccaagcattacggcacatgggacaggctcatgcagcgctttccgcacggcgccccc
gccatgcgcagctgcaccgccatgcaggtgcgcggagacgtccgcttcggcgatgacgta
gccctcgacggagaagtccgcatccgtaacagtgcaaaggcacaggctgtcatccccgac
ggcacgcgtctgtctggcgaagtgcacttgtag

DBGET integrated database retrieval system