KEGG   Desulfovibrio vulgaris RCH1: Deval_2152Help
Entry
Deval_2152        CDS       T02064                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dvg00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dvg00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dvg00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dvg00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2420802..2422274
Genome map
AA seq 490 aa AA seqDB search
MTASTGEQSPFMESSAPMSPRPEHATHSARESFSRLMREERLPGELIDLFLGYHGEIEAS
HTGLIGENDILPAKVEDFTHLDSLTRYAPEGRKLMHRAVCIRLNGGLGTSMGMTHAKSLL
PARHDRSFLDIIHGQAEHQRKAHGGASPLLFMNSYATHADTLRALESMAAPEHMPRCFLQ
HRFPKVDRATLLPVRSHEAGDMAWNPPGHGDIYAALVLSGMLDALLSEGRRWALVANADN
LGASLDPAILGYMAAHRIPFLMECARRTPADSKGGHLARTPEGGLVLREVAQCPADDMAH
FQDIHRYGLFNTNNIWLDLAALRDRVERYGLLRLPLILNPKTLDPRDPESTPVWQVETAM
GAAIALFPGATAIVTPRRRFLPVKRCNDLLLLWSDCFSLGEDFHLNRRVAHDSPLPRIDL
DPKHYGTWDRLMQRFPHGAPAMRSCTAMQVRGDVRFGDDVALDGEVRIRNSAKAQAVIPD
GTRLSGEVHL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccaccggtgaacaaagcccatttatggaatcgagcgcccccatgtcacct
cgccccgaacatgcgacacattccgcgcgcgagtcgttcagtcgcctcatgcgtgaagag
aggctgccgggcgaactcatcgacctcttcctcggctatcatggcgaaatcgaggccagc
cataccggactcatcggtgagaatgacatcctgcccgccaaggtcgaggatttcacccat
ctcgacagcctgacccgctatgcccccgaaggccgcaagctgatgcaccgcgccgtctgc
atcaggctcaatggtggtctcggcaccagcatgggcatgacacacgccaagtcgcttctg
ccagcacgacacgacaggagttttctcgacatcatccacggacaggcagaacatcagcgc
aaggcccacggcggcgcatcgcccctgctgttcatgaacagctacgccacgcacgccgac
accctgcgtgccctcgaaagcatggcggcccccgaacacatgccgcgttgcttcctgcag
catcgtttccccaaggtcgaccgcgccacactccttcccgtacgaagccatgaagccggc
gacatggcgtggaaccctccggggcacggcgacatctacgccgccctcgtactctcgggc
atgctcgacgccctgctttccgaaggtcgccgatgggcgctggttgccaacgccgacaat
ctaggggcatcactcgacccggccattctcggctacatggcggcacatcgcatccccttt
ctcatggaatgcgcccgtcgcacccccgccgacagcaagggcgggcaccttgcccgcaca
ccggaaggcggtctcgtcctgcgcgaggtggcacagtgccctgccgacgacatggcccac
tttcaggacatccatcgctacggactcttcaataccaacaacatatggctcgacctcgcg
gcactgcgtgacagggttgaacgctacggcctgttgcggttgcccctcatcctcaatccc
aagacgctcgacccccgcgaccccgaatccactcccgtctggcaggtggaaacggccatg
ggggcggccatcgccctctttccgggtgcgacagccatcgtcaccccccgccgccgcttt
ctgccggtcaaacgctgcaacgacctgctgctactctggtcggactgcttcagcctcggc
gaggacttccacctcaatcgccgcgtggcgcatgacagccccctgccccgcatcgacctc
gaccccaagcattacggcacatgggacaggctcatgcagcgctttccgcacggcgccccc
gccatgcgcagctgcaccgccatgcaggtgcgcggagacgtccgcttcggcgatgacgta
gccctcgacggagaagtccgcatccgtaacagtgcaaaggcacaggctgtcatccccgac
ggcacgcgtctgtctggcgaagtgcacttgtag

DBGET integrated database retrieval system