KEGG   Desulfovibrio vulgaris RCH1: Deval_2314Help
Entry
Deval_2314        CDS       T02064                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00300  Lysine biosynthesis
dvg00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Deval_2314
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Deval_2314
Enzymes [BR:dvg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Deval_2314
Peptidoglycan biosynthesis and degradation proteins [BR:dvg01011]
 Precursor biosynthesis
  Amino acid ligase
   Deval_2314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ADP87458
JGI: Deval_2314
UniProt: A0A0E0T4M9
Position
complement(2625218..2626678)
Genome map
AA seq 486 aa AA seqDB search
MKPEQVTFDTLLGRVAATLPQIRTDSRRVGPGDVFVAVPGVAVDGAAFITQAVAQGATMV
VCRADGLQHLPEAAFAVAVHDDPRAALGALGQARYGTASLPFPVVGVTGTNGKTTITYLL
EHLFASAGRRCGVLGTVSYRWPGHVEAAPLTTPDCLQLHEMLGQMAGAGVDVAFMEVSSH
ALDQERVAGIRFAGAVLTNLTQDHLDYHGDMETYFNAKARLFRELPEVGKHCAVNADDPW
GRRLLADLPGAVGFALTGAPVSGTRHLHGEMLRCSTAGVHLRMHFEGRTWEVDSPLVGAH
NASNLLAVQAVGLGLGLSPADFVHLENFTGVPGRLERITNDRGLDVFVDYAHTPDALVNV
LRALRDVGFTRIVTVFGCGGNRDRTKRPLMGAAVAAHADVAVLTSDNPRHEDPLAIMEDV
KPGLAGAREVVAEADRRKAIALALEMLRPGDALLVAGKGHEDYQQVGDRKLPFSDQQTIR
EILGCN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgaacaagtgacgttcgatacccttctcgggcgcgttgccgcgaccctccca
cagatacggaccgattcgcgcagagtcggtccgggcgacgttttcgtggccgttcccggc
gtcgccgtggacggggccgccttcatcacgcaggcggtggcgcagggggcgaccatggtc
gtgtgccgtgcagacggcctgcaacacctgccggaagccgcctttgccgtggctgtgcat
gacgacccccgcgccgcgctcggtgcgctcgggcaggcgcgttacggcacggcatcgttg
ccctttcccgttgtcggcgtgacaggtacgaacggcaagacgacgataacctacctgctc
gaacatcttttcgcctcggcaggccgccggtgcggcgtgctcggaacggtaagttaccgg
tggcccgggcatgtcgaggccgccccgctgaccactccagactgtctgcaactacacgag
atgcttggccagatggcgggtgcgggtgtggatgtcgccttcatggaagtgtcgtcgcac
gcgcttgatcaggagcgggtcgcgggcatacgtttcgccggggcggtgctcaccaacctc
acgcaagaccacctcgactaccatggcgacatggagacctacttcaacgccaaggcacgc
cttttcagggagttgccggaagtcggcaagcattgtgccgtcaatgccgacgacccctgg
gggcggcgtctgctcgccgacctgccgggtgcagtcggtttcgccctcaccggtgcgccc
gtgtccggaacgaggcacctgcatggtgagatgctgcgctgctcgactgcgggcgttcac
ctgcgcatgcacttcgagggccgcacgtgggaggtcgactctccgctcgtgggcgcacac
aacgcctcgaacctgctggccgttcaggccgtgggtctcgggcttggcctctcgcccgcc
gattttgttcatcttgaaaatttcaccggagttcccggcaggttggagcgtatcaccaac
gaccgggggcttgacgttttcgtcgattacgcccatacgccggacgccctcgtcaacgtg
ctgcgcgcgttgcgcgatgtgggcttcacgcgcatcgtcacggtcttcggctgcggcggc
aaccgcgaccgcaccaaacgccccctcatgggcgctgccgtggccgcacatgccgacgtg
gccgtcctcacgtccgacaacccccgccatgaagacccgctcgccatcatggaagacgtg
aagcccggccttgccggggcgcgtgaggtcgtggcggaggccgacaggcgcaaggccatc
gcccttgcgttggagatgctgcgtcccggagacgcgcttctcgtggcaggcaaggggcat
gaggactatcagcaggtgggcgaccgcaagctgcctttcagcgaccaacagaccatccgg
gagattcttgggtgcaactga

DBGET integrated database retrieval system