KEGG   Desulfovibrio vulgaris RCH1: Deval_2377Help
Entry
Deval_2377        CDS       T02064                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dvg01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dvg00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2691720..2692820
Genome map
AA seq 366 aa AA seqDB search
MSSLEDILALTSALIRYRSTDTRPEERDRCAAHIMRWCDAEDIASSRVDNNGVTSLIIGP
ASKRAPLLFMAHYDVVEGPDALFQPVLSDSVLKGRGSIDDKYAVALSLVLFRDHLRHLRA
QGRSQDDMPLQLLITGDEETGGYDGARHALGHVGAEFCIALDGGSPSTVITKEKGIIDCT
LTAHGRAAHGARPWLGTNAVECLMADYMALKRLFPGQDDPTDPIHWHRSLNLGIVRAGSA
VNQVPDLATAWLDVRYTEHDDPQALFAAMQESIRGELVATRTEPVFHSGETPWIDRLLAC
APGASTGFAHGASDARFLSEHGIPGVVWGAEGETSQHGPDEHLLVDSLDTVHKALAAFVR
TAGGTA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccttgaagatattctcgccctcacatcggccctcatccgctaccggtccacc
gacacccgtccggaagagcgcgaccgctgcgccgcgcacatcatgcgctggtgcgatgca
gaagatatcgcctcgtctcgtgtggacaacaacggcgtcacttcgctcatcatcggtccg
gcgtcgaagcgcgcgcctctactgttcatggcccattacgatgtcgtggaaggcccggac
gccctgttccagcccgtcctcagcgacagcgtgctcaaaggacgcggcagcatcgacgac
aagtacgccgtagccctctcgcttgtgctgttccgtgatcatctgcgccacctgcgcgca
cagggccgctctcaggacgacatgcccctgcagctgctcatcaccggagacgaggagact
ggaggctacgacggagcccgtcatgctctcggccatgtgggggcggagttctgcatcgct
ctcgacggcgggtcgccctccacggtcatcaccaaggagaagggcatcatcgactgcacg
ctcaccgctcatggcagggccgcccacggtgcccgcccatggctcggcaccaatgccgtg
gaatgcctcatggccgattatatggccctgaaacgactctttcccggacaggacgacccc
accgaccccatacactggcaccgcagcctgaacctcggcatcgttcgcgccgggtctgcc
gtcaatcaggttcccgacctcgccacggcatggctcgacgtgcgctacaccgaacacgac
gacccgcaggcccttttcgctgccatgcaggaatccatacgcggagaactggtcgccacg
cgcaccgagcctgtcttccactccggcgagacaccatggattgacagactgctggcctgt
gcccccggtgcgtccacagggttcgcccacggagcgagcgacgcccgcttcctttcagaa
catggcattccgggcgttgtgtggggcgcagagggagagaccagccagcacggccccgat
gagcaccttcttgtggacagcctcgatacggtccacaaggccctcgccgcattcgtgcgg
acggcagggggcacggcatga

DBGET integrated database retrieval system