KEGG   Desulfovibrio vulgaris RCH1: Deval_2377Help
Entry
Deval_2377        CDS       T02064                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deval_2377
  Amino acid metabolism
   00300 Lysine biosynthesis
    Deval_2377
Enzymes [BR:dvg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Deval_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2691720..2692820
Genome map
AA seq 366 aa AA seqDB search
MSSLEDILALTSALIRYRSTDTRPEERDRCAAHIMRWCDAEDIASSRVDNNGVTSLIIGP
ASKRAPLLFMAHYDVVEGPDALFQPVLSDSVLKGRGSIDDKYAVALSLVLFRDHLRHLRA
QGRSQDDMPLQLLITGDEETGGYDGARHALGHVGAEFCIALDGGSPSTVITKEKGIIDCT
LTAHGRAAHGARPWLGTNAVECLMADYMALKRLFPGQDDPTDPIHWHRSLNLGIVRAGSA
VNQVPDLATAWLDVRYTEHDDPQALFAAMQESIRGELVATRTEPVFHSGETPWIDRLLAC
APGASTGFAHGASDARFLSEHGIPGVVWGAEGETSQHGPDEHLLVDSLDTVHKALAAFVR
TAGGTA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccttgaagatattctcgccctcacatcggccctcatccgctaccggtccacc
gacacccgtccggaagagcgcgaccgctgcgccgcgcacatcatgcgctggtgcgatgca
gaagatatcgcctcgtctcgtgtggacaacaacggcgtcacttcgctcatcatcggtccg
gcgtcgaagcgcgcgcctctactgttcatggcccattacgatgtcgtggaaggcccggac
gccctgttccagcccgtcctcagcgacagcgtgctcaaaggacgcggcagcatcgacgac
aagtacgccgtagccctctcgcttgtgctgttccgtgatcatctgcgccacctgcgcgca
cagggccgctctcaggacgacatgcccctgcagctgctcatcaccggagacgaggagact
ggaggctacgacggagcccgtcatgctctcggccatgtgggggcggagttctgcatcgct
ctcgacggcgggtcgccctccacggtcatcaccaaggagaagggcatcatcgactgcacg
ctcaccgctcatggcagggccgcccacggtgcccgcccatggctcggcaccaatgccgtg
gaatgcctcatggccgattatatggccctgaaacgactctttcccggacaggacgacccc
accgaccccatacactggcaccgcagcctgaacctcggcatcgttcgcgccgggtctgcc
gtcaatcaggttcccgacctcgccacggcatggctcgacgtgcgctacaccgaacacgac
gacccgcaggcccttttcgctgccatgcaggaatccatacgcggagaactggtcgccacg
cgcaccgagcctgtcttccactccggcgagacaccatggattgacagactgctggcctgt
gcccccggtgcgtccacagggttcgcccacggagcgagcgacgcccgcttcctttcagaa
catggcattccgggcgttgtgtggggcgcagagggagagaccagccagcacggccccgat
gagcaccttcttgtggacagcctcgatacggtccacaaggccctcgccgcattcgtgcgg
acggcagggggcacggcatga

DBGET integrated database retrieval system