KEGG   Desulfovibrio vulgaris RCH1: Deval_2444Help
Entry
Deval_2444        CDS       T02064                                 

Definition
(RefSeq) D-cysteine desulfhydrase family pyridoxal phosphate-dependent protein
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Deval_2444
Enzymes [BR:dvg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Deval_2444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(2766362..2767360)
Genome map
AA seq 332 aa AA seqDB search
MNLAVFPRRGYVKDPTPIESCPAFSKALGGKVNIFIKRDDLLPGCAGGNKTRKLDFCMAD
ALAKGADTIITCGAVQSNHCRLTLSWAVKEGLDCHLVLEERVKGSYKPEASGNNFLFKLM
GVKSITVVPGGSNMMGEMEALAARLKEAGRTPYIIPGGASNPIGATGYVSCAQETLQQLF
DMGLKVDHMVVPSGSAGTHAGIVVGMVGNNANIPVSGINVSRTKADQEALVRKLARETAQ
RVGMSGEFPDEAVTCFDGYVGPGYSLPTESMVEAVRLLAQTEGILLDPVYSGKAMAGLVD
LVRSGYFAEGSNVLFLHTGGSPALYAYLDTFK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgctgtttttcccagacgtggctatgtcaaggaccccacccccatcgaatcg
tgtccggctttttcgaaggctctgggcggcaaggtcaacatcttcatcaagcgtgatgac
ctgctgcccggctgcgccgggggcaacaagacccgcaagctggacttctgcatggcggat
gccctcgccaagggcgctgacaccatcatcacctgcggggccgtgcagtccaaccattgc
cgcctgaccctgtcgtgggctgtcaaggaagggctcgactgccatctcgtccttgaggag
cgtgtcaagggcagctacaagcccgaagcttcgggcaacaacttcctgttcaagctcatg
ggtgtgaagagcatcaccgtcgtgcccggcggttccaacatgatgggggaaatggaagca
ctcgctgcacgcctcaaggaagcagggcgtactccctacatcatccccggtggagcatcg
aaccccatcggggccaccggctatgtctcttgcgcgcaggagaccctccagcaactcttc
gacatgggactcaaggtggatcacatggtggttcccagcggtagcgccgggacccatgcc
ggcatcgtcgtcggcatggtgggcaacaacgccaacatccctgtctccggcatcaacgtg
agccgcaccaaggccgaccaggaggcactggtgcgcaagctggcccgcgagacggcgcag
cgcgtgggcatgagtggcgagttccccgatgaagcggtgacctgctttgacggttatgtg
ggccccggctattcgctgcccaccgagagcatggtcgaagccgtgcgtcttctggcccag
accgaaggcatactgctcgacccggtgtactcgggcaaggccatggccggtcttgtggac
ctcgtgcgtagcggctactttgccgaaggttcgaatgtgcttttcctgcacaccggtgga
tcgccagcgctttacgcctacctcgatacgttcaagtaa

DBGET integrated database retrieval system