KEGG   Desulfovibrio vulgaris RCH1: Deval_2444Help
Entry
Deval_2444        CDS       T02064                                 

Definition
D-cysteine desulfhydrase family pyridoxal phosphate-dependent protein
Organism
dvg  Desulfovibrio vulgaris RCH1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2766362..2767360)
Genome map
AA seq 332 aa AA seqDB search
MNLAVFPRRGYVKDPTPIESCPAFSKALGGKVNIFIKRDDLLPGCAGGNKTRKLDFCMAD
ALAKGADTIITCGAVQSNHCRLTLSWAVKEGLDCHLVLEERVKGSYKPEASGNNFLFKLM
GVKSITVVPGGSNMMGEMEALAARLKEAGRTPYIIPGGASNPIGATGYVSCAQETLQQLF
DMGLKVDHMVVPSGSAGTHAGIVVGMVGNNANIPVSGINVSRTKADQEALVRKLARETAQ
RVGMSGEFPDEAVTCFDGYVGPGYSLPTESMVEAVRLLAQTEGILLDPVYSGKAMAGLVD
LVRSGYFAEGSNVLFLHTGGSPALYAYLDTFK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgctgtttttcccagacgtggctatgtcaaggaccccacccccatcgaatcg
tgtccggctttttcgaaggctctgggcggcaaggtcaacatcttcatcaagcgtgatgac
ctgctgcccggctgcgccgggggcaacaagacccgcaagctggacttctgcatggcggat
gccctcgccaagggcgctgacaccatcatcacctgcggggccgtgcagtccaaccattgc
cgcctgaccctgtcgtgggctgtcaaggaagggctcgactgccatctcgtccttgaggag
cgtgtcaagggcagctacaagcccgaagcttcgggcaacaacttcctgttcaagctcatg
ggtgtgaagagcatcaccgtcgtgcccggcggttccaacatgatgggggaaatggaagca
ctcgctgcacgcctcaaggaagcagggcgtactccctacatcatccccggtggagcatcg
aaccccatcggggccaccggctatgtctcttgcgcgcaggagaccctccagcaactcttc
gacatgggactcaaggtggatcacatggtggttcccagcggtagcgccgggacccatgcc
ggcatcgtcgtcggcatggtgggcaacaacgccaacatccctgtctccggcatcaacgtg
agccgcaccaaggccgaccaggaggcactggtgcgcaagctggcccgcgagacggcgcag
cgcgtgggcatgagtggcgagttccccgatgaagcggtgacctgctttgacggttatgtg
ggccccggctattcgctgcccaccgagagcatggtcgaagccgtgcgtcttctggcccag
accgaaggcatactgctcgacccggtgtactcgggcaaggccatggccggtcttgtggac
ctcgtgcgtagcggctactttgccgaaggttcgaatgtgcttttcctgcacaccggtgga
tcgccagcgctttacgcctacctcgatacgttcaagtaa

DBGET integrated database retrieval system