KEGG   Desulfovibrio vulgaris RCH1: Deval_2711Help
Entry
Deval_2711        CDS       T02064                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deval_2711
   01230 Biosynthesis of amino acids
    Deval_2711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deval_2711
  Energy metabolism
   00680 Methane metabolism
    Deval_2711
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_2711
Enzymes [BR:dvg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Deval_2711
Exosome [BR:dvg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Deval_2711
  Exosomal proteins of melanoma cells
   Deval_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3043488..3044240
Genome map
AA seq 250 aa AA seqDB search
MARLILLRHGQSAWNLENRFTGWTDVDLSPAGEAEALAAARLIRDEGLDFSVCHTSMLTR
AIRTLHLVQQELDRLWTPVRKHWRLNERHYGALQGLDKRETAARHGEDQVFVWRRSYDVP
PPVIAPDDPKHPVHDPRYADVPPDVLPCGESLEATVARVLPYWYDAIAPDLMAGRDVLVA
AHGNSLRALVMHLDGLDREDVSRLDIPTGLPRLYELDAALRPVSYRYLGDPAEAEERARA
VAAQGRLEKN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctcatccttctcagacacgggcagagtgcatggaaccttgaaaaccgcttc
accgggtggacggacgtagacctctccccggcaggcgaagccgaggcactggccgcggca
cggctcatccgggatgaagggctcgacttctccgtgtgccacacctccatgctgacccgt
gccatacgcacgctgcatcttgtacagcaagaactggacaggctctggacgcccgtacgc
aagcactggcgtctcaatgaacggcactacggggccctgcaggggctggacaaacgcgag
accgcggcacgacacggcgaagaccaggtcttcgtctggcggcgcagctacgatgtgccg
ccgcccgtcatcgcccccgacgacccgaagcaccccgtccacgacccccgctacgccgat
gtgccccctgatgtccttccctgtggcgaaagccttgaagcgaccgtggcgcgggtactc
ccctactggtacgacgccatcgcccccgacctcatggcggggcgcgatgtgctggtggcg
gcccacggcaacagcctgcgcgcccttgtcatgcatcttgacgggcttgaccgcgaggat
gtttcacgcctcgacatccccaccgggctgccccgcctgtacgaactggatgccgcactg
cgccccgtgtcgtaccgctatctgggagacccggcagaggctgaggaacgggcacgcgcc
gtagccgcgcaggggcggctcgaaaagaactga

DBGET integrated database retrieval system