KEGG   Desulfovibrio vulgaris RCH1: Deval_2711Help
Entry
Deval_2711        CDS       T02064                                 

Definition
phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deval_2711
   01230 Biosynthesis of amino acids
    Deval_2711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deval_2711
  Energy metabolism
   00680 Methane metabolism
    Deval_2711
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_2711
Enzymes [BR:dvg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Deval_2711
Exosome [BR:dvg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Deval_2711
  Exosomal proteins of melanoma cells
   Deval_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3043488..3044240
Genome map
AA seq 250 aa AA seqDB search
MARLILLRHGQSAWNLENRFTGWTDVDLSPAGEAEALAAARLIRDEGLDFSVCHTSMLTR
AIRTLHLVQQELDRLWTPVRKHWRLNERHYGALQGLDKRETAARHGEDQVFVWRRSYDVP
PPVIAPDDPKHPVHDPRYADVPPDVLPCGESLEATVARVLPYWYDAIAPDLMAGRDVLVA
AHGNSLRALVMHLDGLDREDVSRLDIPTGLPRLYELDAALRPVSYRYLGDPAEAEERARA
VAAQGRLEKN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctcatccttctcagacacgggcagagtgcatggaaccttgaaaaccgcttc
accgggtggacggacgtagacctctccccggcaggcgaagccgaggcactggccgcggca
cggctcatccgggatgaagggctcgacttctccgtgtgccacacctccatgctgacccgt
gccatacgcacgctgcatcttgtacagcaagaactggacaggctctggacgcccgtacgc
aagcactggcgtctcaatgaacggcactacggggccctgcaggggctggacaaacgcgag
accgcggcacgacacggcgaagaccaggtcttcgtctggcggcgcagctacgatgtgccg
ccgcccgtcatcgcccccgacgacccgaagcaccccgtccacgacccccgctacgccgat
gtgccccctgatgtccttccctgtggcgaaagccttgaagcgaccgtggcgcgggtactc
ccctactggtacgacgccatcgcccccgacctcatggcggggcgcgatgtgctggtggcg
gcccacggcaacagcctgcgcgcccttgtcatgcatcttgacgggcttgaccgcgaggat
gtttcacgcctcgacatccccaccgggctgccccgcctgtacgaactggatgccgcactg
cgccccgtgtcgtaccgctatctgggagacccggcagaggctgaggaacgggcacgcgcc
gtagccgcgcaggggcggctcgaaaagaactga

DBGET integrated database retrieval system