KEGG   Desulfovibrio vulgaris RCH1: Deval_2893Help
Entry
Deval_2893        CDS       T02064                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Deval_2893
Enzymes [BR:dvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Deval_2893
Exosome [BR:dvg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deval_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3284159..3285652
Genome map
AA seq 497 aa AA seqDB search
MSNYVLALDQGTTSSRAILFTREGDIKQISQKEFTQIYPQPGWVEHNANEIFDTQSWVMR
ECLQEAGIGAADVVAAGITNQRETTVVWDKATGAPVYNAIVWQDRRTAGFCDELKARGLA
DVFRKKTGLVLDAYFSGTKVRWILDNVPGARAKAEKGELLFGTIDTWLIWNLTKGKAHVT
DSSNASRTLMFNINTGAWDDELLGILDVPRSMLPRVTGSSEVVGDIHPEFLGKAIPIAGN
AGDQQAATYGNACLKPGMAKNTYGTGCFMLMNTGTEVRSSQNNLLSTVAWTTPSGRFYAL
EGSVFIAGAVVQWLRDGLGIIKAAPEVEQLALSVPDNGGVYLVPAFAGLGAPHWDQYARG
TMVGITRGATKAHIARAALESIALQTLDIMDCMQKDSGIKLAALRADGGATRNNLLMQFQ
ADVLGVPVERLKVTETTALGAAYLAGLATGFWKSEDEIATMWQLDRRFEPNMSDDKRQHL
VYEWQRAVERAKAWVEA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactacgtcctcgccctcgaccagggcaccaccagctcccgcgccatcctcttc
acgcgcgaaggtgacatcaagcagatttcgcagaaggaattcacccagatttacccccag
ccgggctgggtggagcacaacgccaacgagatattcgacacccagtcgtgggtcatgcgc
gagtgcctgcaagaggccggcatcggtgccgcggacgtcgtggccgcgggcatcaccaac
cagcgtgagacgaccgtggtgtgggacaaggccaccggcgcccccgtctacaacgccatc
gtgtggcaagaccgccgcaccgcaggcttctgcgacgaactcaaggcccgcggcctcgcc
gacgtgttccgcaagaagaccggcctcgtgctcgatgcgtacttctccggcaccaaggtg
cgctggatactcgacaacgtgccgggagcccgcgccaaggccgaaaagggcgaattgctg
ttcggcaccatcgacacatggctcatctggaacctcaccaagggcaaggcgcacgtcacc
gactcgtccaacgccagccgtaccctcatgttcaacatcaacacgggcgcgtgggatgac
gagcttctgggcatcctcgacgttccgcgctccatgctgccccgcgtgaccggttcgtcc
gaggtcgtgggtgacatccacccagaattcctcggcaaggccattcccatcgccggcaat
gcgggcgaccagcaggccgccacctacggcaacgcctgcctcaagcccggcatggccaag
aacacctacggcaccggctgcttcatgctcatgaacaccggcaccgaagtccgttccagc
cagaacaacctgctgagcaccgtggcatggacgaccccctcgggacgtttctacgccctg
gaaggcagcgtgttcatcgcaggcgcagtggtacagtggctgcgtgacggtctcggcatc
atcaaggccgcccccgaagtggaacaactggccctgagcgtccccgacaacggcggcgtc
tacctcgtgcccgccttcgcgggactgggtgccccccactgggaccagtacgcccgtggc
accatggtcggcatcacccgcggcgcgacgaaggcccacatcgcacgtgccgcgctcgag
tccatcgccttgcagaccctcgacatcatggactgcatgcagaaggactcgggcatcaag
ctggccgcactgcgcgctgacggcggcgccacccgcaacaacctgctgatgcagttccag
gccgacgttctcggcgtgcccgtcgagcgtctcaaggtcactgagaccacggccctcggc
gcagcctacctcgcgggtctcgccaccggattctggaagagcgaagacgagatagccacc
atgtggcaactcgaccgccgcttcgagcccaacatgtccgacgacaagcgccagcacctc
gtctacgaatggcagcgtgccgtagaacgcgccaaggcgtgggtcgaggcatag

DBGET integrated database retrieval system