KEGG   Desulfovibrio vulgaris RCH1: Deval_2957Help
Entry
Deval_2957        CDS       T02064                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deval_2957
DNA repair and recombination proteins [BR:dvg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Deval_2957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3365947..3366552
Genome map
AA seq 201 aa AA seqDB search
MQRLPEPLKALVDQLAKLPGLGPKSALRLAMTLLKWPASETRRLGRGIHDLRDNLHLCRR
CGALTDCDPCALCTDATRTQDMLCLVSEWDSMLTLEEGGFYRGQYLILGGLLAPLDNVNA
DSLELERLTRRLAEGQVREVVLALGTTVEAENTATFIRAMVERQYPGVRVTRLAQGIPLG
AEVKFMDRETLRQSMQYRQEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgtcttccagaacccttgaaggccctcgtggaccagctggcgaaactgccggga
ctgggccccaagtcggccctgcgccttgccatgacgctgctcaaatggcccgccagcgag
acgcgacgtctcgggcggggcatccacgacctgcgcgacaacctgcacctgtgcaggcgt
tgcggtgcgctcaccgactgcgacccctgcgccctgtgcaccgatgccacccgcacacag
gacatgctgtgtctcgtctccgaatgggacagcatgctcacgctggaagagggcggcttc
tacagggggcagtacctcattctcggcggcctgctggcaccgctggacaatgtgaacgcc
gactcgctggaactggaaaggctcacccgtcgcctcgctgaagggcaggtgcgcgaggtg
gtgctggcgctgggaaccaccgtggaggccgagaacaccgccaccttcatccgggcaatg
gtcgaacgccagtaccccggcgtccgtgtgaccagactcgcgcagggcatccccctcggg
gccgaggtcaagttcatggaccgtgagaccctgcgccagtccatgcagtaccggcaggaa
ctgtga

DBGET integrated database retrieval system