KEGG   Desulfovibrio vulgaris RCH1: Deval_2967Help
Entry
Deval_2967        CDS       T02064                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deval_2967
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_2967
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Deval_2967
Enzymes [BR:dvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Deval_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3378420..3379868
Genome map
AA seq 482 aa AA seqDB search
MPSCDFPGWRSRMEYVCLGCGARHSIDELLYTCPSCGGVFLLEDLDFDHLADHRSGDDWR
TLFDSRASTRCRSLRGIFRFYELMAPVLEEDDIIYLGEGNTPVVDASPALERSVGQRFAY
KNDGQNPSASFKDRGMACAFSYLRALVRKHGWDEVLTICASTGDTSAAAALYASYVGSPI
KSAVILPHGKVTPQQLSQPLGSGATVLEIPGVFDDCMKVVEHLAENYRVALLNSKNSWRI
LGQESYAFEVAQWYGWDMAGKCVFVPIGNAGNITAVMSGFLKMHRLGIIDALPRVFGVQS
HHADPVYRYYSVEDPRQRHYEPVTVQPSVAQAAMIGNPVSFPRVRHLAERFEALGGPGAF
QVVQVTEQAIMDSMIRANRHGHIACTQGGECLAGLLRAKELGLVDKDETAVLDATAHSLK
FSGFQDMYFTNGFPPAYGVTPDATLGNAPSLVLHDEDKVALAEKYTVEAAQRIAAKLGLA
GK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctgtgattttcccggctggcgcagccggatggaatatgtctgcctcggatgc
ggggcacggcactccatagacgaactgctctacacctgcccctcgtgcggcggggtcttc
ctgcttgaagacctcgacttcgaccacctcgccgaccaccgtagcggcgacgactggcgc
acgctcttcgactcccgggcatccacccggtgccgttcgctgcgcggcatcttccgcttc
tatgaattgatggcccccgtccttgaagaggacgacatcatctatcttggcgaaggcaat
acgccggtggtggatgcctcgcccgccctcgaaagaagcgtcgggcagcgtttcgcctac
aagaacgacggccagaaccccagtgcatcgttcaaggacaggggcatggcctgcgccttc
agctacctgcgcgcactggtacgcaagcacggctgggacgaggtgctcaccatctgcgcc
tccacgggtgacacgtccgccgcagcggccctgtacgcctcgtatgtgggttcccccatc
aagtcggcggtcatcctgccccacggcaaggtcaccccgcagcagctttcgcagcctctt
ggcagcggggccacggtgctcgagattcccggcgtgttcgacgactgcatgaaagtggtc
gagcaccttgccgagaactaccgcgtcgccctgctcaactccaagaacagctggcgcatc
ctcgggcaggagtcgtacgccttcgaagtggcccagtggtacggctgggacatggcgggc
aagtgcgtcttcgtgcccatcggcaacgcaggcaacatcaccgctgtcatgtcgggcttt
ctcaagatgcaccgtcttggcatcatcgacgcccttccgcgcgtcttcggggtgcagtcg
caccacgccgaccccgtctaccgctactacagcgtcgaagaccccaggcagcgccactac
gaacccgtcaccgtccagcccagcgtggcgcaggcggcaatgatcggaaaccccgtgtcc
ttcccccgcgtgaggcacctcgccgaacggttcgaggccctcggcggccccggtgccttc
caggtggtgcaggtgacggaacaggccatcatggattccatgatccgcgccaaccgccat
gggcacatcgcctgcacgcagggtggcgagtgccttgcgggacttctgcgcgccaaggaa
ctgggtcttgtcgacaaggacgagacggcggtgctcgacgccacggcacacagcctcaag
ttctcgggctttcaggacatgtacttcaccaatggttttccgcccgcctatggcgtcacg
cccgacgccactctcggcaacgcgccctcgctggtgctgcacgatgaggacaaggtggca
ctggctgaaaagtacaccgtcgaagcggcccagcgcatcgcggcgaagcttggactggct
ggcaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system