KEGG   Desulfovibrio vulgaris RCH1: Deval_2967Help
Entry
Deval_2967        CDS       T02064                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00260  Glycine, serine and threonine metabolism
dvg00750  Vitamin B6 metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
dvg01120  Microbial metabolism in diverse environments
dvg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_2967
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Deval_2967
Enzymes [BR:dvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Deval_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zf-TFIIB Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ADP88109
JGI: Deval_2967
UniProt: A0A0E0T6R3
Position
3378420..3379868
Genome map
AA seq 482 aa AA seqDB search
MPSCDFPGWRSRMEYVCLGCGARHSIDELLYTCPSCGGVFLLEDLDFDHLADHRSGDDWR
TLFDSRASTRCRSLRGIFRFYELMAPVLEEDDIIYLGEGNTPVVDASPALERSVGQRFAY
KNDGQNPSASFKDRGMACAFSYLRALVRKHGWDEVLTICASTGDTSAAAALYASYVGSPI
KSAVILPHGKVTPQQLSQPLGSGATVLEIPGVFDDCMKVVEHLAENYRVALLNSKNSWRI
LGQESYAFEVAQWYGWDMAGKCVFVPIGNAGNITAVMSGFLKMHRLGIIDALPRVFGVQS
HHADPVYRYYSVEDPRQRHYEPVTVQPSVAQAAMIGNPVSFPRVRHLAERFEALGGPGAF
QVVQVTEQAIMDSMIRANRHGHIACTQGGECLAGLLRAKELGLVDKDETAVLDATAHSLK
FSGFQDMYFTNGFPPAYGVTPDATLGNAPSLVLHDEDKVALAEKYTVEAAQRIAAKLGLA
GK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctgtgattttcccggctggcgcagccggatggaatatgtctgcctcggatgc
ggggcacggcactccatagacgaactgctctacacctgcccctcgtgcggcggggtcttc
ctgcttgaagacctcgacttcgaccacctcgccgaccaccgtagcggcgacgactggcgc
acgctcttcgactcccgggcatccacccggtgccgttcgctgcgcggcatcttccgcttc
tatgaattgatggcccccgtccttgaagaggacgacatcatctatcttggcgaaggcaat
acgccggtggtggatgcctcgcccgccctcgaaagaagcgtcgggcagcgtttcgcctac
aagaacgacggccagaaccccagtgcatcgttcaaggacaggggcatggcctgcgccttc
agctacctgcgcgcactggtacgcaagcacggctgggacgaggtgctcaccatctgcgcc
tccacgggtgacacgtccgccgcagcggccctgtacgcctcgtatgtgggttcccccatc
aagtcggcggtcatcctgccccacggcaaggtcaccccgcagcagctttcgcagcctctt
ggcagcggggccacggtgctcgagattcccggcgtgttcgacgactgcatgaaagtggtc
gagcaccttgccgagaactaccgcgtcgccctgctcaactccaagaacagctggcgcatc
ctcgggcaggagtcgtacgccttcgaagtggcccagtggtacggctgggacatggcgggc
aagtgcgtcttcgtgcccatcggcaacgcaggcaacatcaccgctgtcatgtcgggcttt
ctcaagatgcaccgtcttggcatcatcgacgcccttccgcgcgtcttcggggtgcagtcg
caccacgccgaccccgtctaccgctactacagcgtcgaagaccccaggcagcgccactac
gaacccgtcaccgtccagcccagcgtggcgcaggcggcaatgatcggaaaccccgtgtcc
ttcccccgcgtgaggcacctcgccgaacggttcgaggccctcggcggccccggtgccttc
caggtggtgcaggtgacggaacaggccatcatggattccatgatccgcgccaaccgccat
gggcacatcgcctgcacgcagggtggcgagtgccttgcgggacttctgcgcgccaaggaa
ctgggtcttgtcgacaaggacgagacggcggtgctcgacgccacggcacacagcctcaag
ttctcgggctttcaggacatgtacttcaccaatggttttccgcccgcctatggcgtcacg
cccgacgccactctcggcaacgcgccctcgctggtgctgcacgatgaggacaaggtggca
ctggctgaaaagtacaccgtcgaagcggcccagcgcatcgcggcgaagcttggactggct
ggcaagtag

DBGET integrated database retrieval system