KEGG   Desulfovibrio vulgaris RCH1: Deval_2967Help
Entry
Deval_2967        CDS       T02064                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deval_2967
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deval_2967
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Deval_2967
Enzymes [BR:dvg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Deval_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
3378420..3379868
Genome map
AA seq 482 aa AA seqDB search
MPSCDFPGWRSRMEYVCLGCGARHSIDELLYTCPSCGGVFLLEDLDFDHLADHRSGDDWR
TLFDSRASTRCRSLRGIFRFYELMAPVLEEDDIIYLGEGNTPVVDASPALERSVGQRFAY
KNDGQNPSASFKDRGMACAFSYLRALVRKHGWDEVLTICASTGDTSAAAALYASYVGSPI
KSAVILPHGKVTPQQLSQPLGSGATVLEIPGVFDDCMKVVEHLAENYRVALLNSKNSWRI
LGQESYAFEVAQWYGWDMAGKCVFVPIGNAGNITAVMSGFLKMHRLGIIDALPRVFGVQS
HHADPVYRYYSVEDPRQRHYEPVTVQPSVAQAAMIGNPVSFPRVRHLAERFEALGGPGAF
QVVQVTEQAIMDSMIRANRHGHIACTQGGECLAGLLRAKELGLVDKDETAVLDATAHSLK
FSGFQDMYFTNGFPPAYGVTPDATLGNAPSLVLHDEDKVALAEKYTVEAAQRIAAKLGLA
GK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctgtgattttcccggctggcgcagccggatggaatatgtctgcctcggatgc
ggggcacggcactccatagacgaactgctctacacctgcccctcgtgcggcggggtcttc
ctgcttgaagacctcgacttcgaccacctcgccgaccaccgtagcggcgacgactggcgc
acgctcttcgactcccgggcatccacccggtgccgttcgctgcgcggcatcttccgcttc
tatgaattgatggcccccgtccttgaagaggacgacatcatctatcttggcgaaggcaat
acgccggtggtggatgcctcgcccgccctcgaaagaagcgtcgggcagcgtttcgcctac
aagaacgacggccagaaccccagtgcatcgttcaaggacaggggcatggcctgcgccttc
agctacctgcgcgcactggtacgcaagcacggctgggacgaggtgctcaccatctgcgcc
tccacgggtgacacgtccgccgcagcggccctgtacgcctcgtatgtgggttcccccatc
aagtcggcggtcatcctgccccacggcaaggtcaccccgcagcagctttcgcagcctctt
ggcagcggggccacggtgctcgagattcccggcgtgttcgacgactgcatgaaagtggtc
gagcaccttgccgagaactaccgcgtcgccctgctcaactccaagaacagctggcgcatc
ctcgggcaggagtcgtacgccttcgaagtggcccagtggtacggctgggacatggcgggc
aagtgcgtcttcgtgcccatcggcaacgcaggcaacatcaccgctgtcatgtcgggcttt
ctcaagatgcaccgtcttggcatcatcgacgcccttccgcgcgtcttcggggtgcagtcg
caccacgccgaccccgtctaccgctactacagcgtcgaagaccccaggcagcgccactac
gaacccgtcaccgtccagcccagcgtggcgcaggcggcaatgatcggaaaccccgtgtcc
ttcccccgcgtgaggcacctcgccgaacggttcgaggccctcggcggccccggtgccttc
caggtggtgcaggtgacggaacaggccatcatggattccatgatccgcgccaaccgccat
gggcacatcgcctgcacgcagggtggcgagtgccttgcgggacttctgcgcgccaaggaa
ctgggtcttgtcgacaaggacgagacggcggtgctcgacgccacggcacacagcctcaag
ttctcgggctttcaggacatgtacttcaccaatggttttccgcccgcctatggcgtcacg
cccgacgccactctcggcaacgcgccctcgctggtgctgcacgatgaggacaaggtggca
ctggctgaaaagtacaccgtcgaagcggcccagcgcatcgcggcgaagcttggactggct
ggcaagtag

DBGET integrated database retrieval system