KEGG   Desulfovibrio vulgaris RCH1: Deval_3167Help
Entry
Deval_3167        CDS       T02064                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dvg  Desulfovibrio vulgaris RCH1
Pathway
dvg00250  Alanine, aspartate and glutamate metabolism
dvg01100  Metabolic pathways
dvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Deval_3167
Enzymes [BR:dvg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Deval_3167
Peptidases [BR:dvg01002]
 Cysteine Peptidases
  Family C44
   Deval_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 TylF Methyltransf_24 DUF3700
Motif
Other DBs
NCBI-ProteinID: ADP88308
JGI: Deval_3167
UniProt: A0A0E0T741
Position
pDEVAL01:complement(92403..95072)
Genome map
AA seq 889 aa AA seqDB search
MCGIAGIISRKDRNVSSQPLNRMLTSQEHRGPDAGYGVSFRRQSTGAFAAGRRHSADALA
AGLEPAPVWLGHRRLSILDLSDKSAQPLRRGDLHIVFNGELFNYIELRSELTALGEHFET
SGDTEVLLASYRHWGAGCLERFNGIFAFAIFDASRGSLFAARDPFGVKPFHYGVKPFHYA
VTHDFLIFASEIKAISASGLVLRKWDPDVASAYLSYALTTAPQGRTFFENIRQIPPGHCL
TLASPDDEPSVTRYYAPRITETPRSLHELVDEGAGLIRQSCRIRMRSDRDVGLCLSSGID
SANVAAALVAEGIAPECYSIDAASSSMLDEFPLITALADKLGLHVNPIRHPDAIPTADIV
RYMLFNDEPSLFWGSYNQFHLYREMRKLGVIVSMSGHGGDELFCGYQRYYPAVVRDMLAQ
RRIMSLIWWCLRQSRHLMQDRRTIRSTWDSYSHPLGWANDYAHDIAALHLKHTIADPEEW
ISTFVGASSWGEQQQKSLFTYELQYLLRDADRNSMAHGIEERVPLLDTRLYEFCASVPLK
DLCQDGYLKGLARQLFPAIPESLRFHQIKRGLYTDISSKLPQLQADLMPLVHRSPLLREL
VDLQKLPQQLPGIVWWRLCSLAVLDVSGIEEWTAQTPLPRLVDDEMAERIGGVPSGTGRT
AVIRHVLDEGLSYLEPGALHGLAETVGLIESAAIPGCIIEAGCALGGSTMVLATAKAKER
PLHVFDVFGCIPPPGSNDGEEARARFAVIAAGESTGLNGKRYYGYEPDLLKNVQDNFVAL
GLPPAEHGITFVPGLYENTLYPSGPVALAHIDCDWYQSVKTCLERIAPHISPGGRMIIDD
YDHYSGCRRAVDEFLEASNGQFIRERYARVHLVRTKADGQETDVHRPGD
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattgcaggcatcatatctcgcaaagacagaaacgtatcgagccagcccctg
aacaggatgctcaccagtcaggagcatcgtgggcctgacgccggttacggtgtatccttt
cggcggcagtcgaccggggccttcgcggcaggacgacgccactcggctgacgccctcgca
gccggcttggaacccgcgccggtctggcttggccacagaaggctgtccattctcgacctc
tccgacaagtcggcccagccgctacgccggggggacctgcatatcgtcttcaatggtgag
ctcttcaactatatcgaacttcgaagtgaactgaccgcactcggcgagcacttcgagacc
tccggagacaccgaggtgcttcttgcgtcctaccgccactggggcgcaggatgccttgaa
cggttcaacggcatattcgccttcgccatcttcgatgccagccgtggcagtcttttcgcc
gcacgcgacccgttcggcgtcaagccgttccactacggcgtcaagccgttccactacgcc
gtcacgcacgatttcctcatcttcgcctcggagatcaaggccatatccgccagcggactg
gtgctgcgaaagtgggacccggacgtggcctccgcctatctttcctatgcgctgacgact
gccccgcagggacggaccttcttcgagaacatcaggcaaatcccgcccggtcactgcctt
acgctcgccagccccgacgatgagccgtcggtgacacgctattacgcgcccagaatcacg
gagacaccgcgtagccttcacgaactcgtcgacgaaggggcggggctcattcgccagtca
tgccgcatacggatgcgcagcgaccgtgatgtcgggctgtgtctcagttcggggatcgat
tccgccaacgtggcggctgcccttgtcgcggaaggcatcgcccctgagtgctattccatc
gacgctgccagttcttcaatgctcgacgaatttccgctcatcacggcgctggctgacaaa
ctggggcttcatgtcaaccccatacggcatcccgacgccattcccacggccgacatcgtc
cgctacatgctgttcaacgacgagccttcgctcttctgggggtcgtacaaccagttccat
ctgtatcgtgaaatgcgcaagctgggtgtcatcgtgtccatgagcggacacggtggcgac
gaactgttctgcggctatcaacggtactatccggctgtcgttcgcgacatgctcgcacag
agacgaatcatgtctctcatctggtggtgtctgcgtcagtcaaggcatctcatgcaggac
agacgcaccatcagaagcacatgggacagctacagccacccgctaggctgggcaaacgac
tacgcacacgacatcgcagccctgcacctcaagcacaccatcgccgaccctgaagaatgg
atttcgacattcgtcggcgcctcttcgtggggggaacaacagcagaaatccctgttcaca
tatgaactgcaatacctgctgcgggacgccgaccggaactccatggcccacggcattgaa
gaacgggttcccctgctggatacgcggctgtacgagttctgtgccagcgtcccgctgaag
gacctgtgtcaggacgggtaccttaagggactcgcacggcagctgttccccgccatccct
gaatcattgcggtttcaccagataaaacgggggctttacacggacatcagctccaagctg
ccacagttgcaggcagacctcatgccccttgtgcaccgaagccccctgctgcgtgagctt
gtcgacctgcagaaactcccgcagcagcttcccggcatcgtctggtggcggctttgcagc
cttgccgtgctggatgtgagcggaatcgaggaatggacggcgcagacccccttgccccga
ctcgtcgacgacgagatggcagagcgcatcgggggggtgccctccggcactggcaggacc
gccgtcatcaggcatgtgctcgacgaggggctttcgtatctcgaaccgggagccctgcac
gggctcgccgagaccgtagggctcatcgaatcggcggcaatcccgggctgtatcatcgaa
gccgggtgtgccctcggcgggtcgaccatggttcttgccacggccaaggctaaagagcga
ccgttgcatgtcttcgatgtcttcgggtgcatcccgccccccggcagcaacgatggcgaa
gaggcacgtgcccgttttgcggtcattgccgccggagagtccacggggctcaacggcaag
cgctattacggctacgaacctgacctgctcaagaatgtgcaggacaacttcgtcgctctc
ggactgccccctgccgaacatggcataaccttcgtccccggcctctacgagaacaccctc
tacccttccgggccggtggcgctggctcacatagattgcgactggtaccagtcggtgaag
acctgccttgagcgtatcgccccccacatctcaccggggggccgcatgatcatcgacgac
tatgaccactacagcggatgccgcagggcggttgacgaattccttgaagcctcgaacgga
caattcatccgcgaacggtacgcccgggttcacctcgtccgcaccaaggctgacggacag
gagacggacgtacaccggcccggcgactag

DBGET integrated database retrieval system