KEGG   Drosophila virilis: Dvir_GJ10123Help
Entry
Dvir_GJ10123      CDS       T01066                                 

Definition
GJ10123 gene product from transcript GJ10123-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dvi  Drosophila virilis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dvi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1324 aa AA seqDB search
MDFLSKLIKRPNSIVLPETEPAPAPGPSASCSSSAPTAVPSSRPSLSSPTAFITLAMDRC
SIDPELDSLFDSAAQDLDSLERQHKDLIDHVDAPVPCPDSAPKSTNSTRETIKQLLSEIN
FNLDQVTAREMEHLQAMSLELSPLAVKPGPARHSLEQQKALVAAMRSTSQPSTPRDKEQP
LLKFTGLPEFDETQIPELAPLSVEMEAQLKSDACAPVLSSTTLKLSEHEYNSDSDVYAEC
LSLNSGKLSADQSDLEAYSSALNDVLEQQQLSNVTATTLENTLSDAAHNNSCEPMDVDDI
NETMELLKDVLAPEDRQQLQQQLLDGAMQQEEEAQQPTQQRGMPKVEEQREEAVPKEQSM
QQKEAVPKEQSMQQDLKLEQSLKLEQFSKLGQSMLKEQETATSQPIAAPAPIYPTVQQTI
PITDLQLEQLVPTASDSDKIKDHLTPNAQTESQPAPAPAPLSPPLPTHQKKQDVEQPVSD
SAASAPLSPLQIPEAVPVSAPLQTPDSVEQLLEQPIPQSDAALIAPTLQAPPCQLLPTSP
PIPTHRMKTPEELVELLALQVYAQPPEEPQQEADVMASADRHVDELQALPPKPVATVAPV
PKQPSPLPALELNISIGSQNGCSGPISPSFPVRSPAESPRHFPRSPHAPAEQEEMQYLEQ
ANIEPAAEPKLCLSGVIARSPLPIQLTVTGSSPEGPLQQPLADNSPLNGTFDSASPESIE
RAGRPSGASFGVALNTAGGQQRRTFLVRTDPAEQQAAKRLSDSQAYDRGQEENQLNATYA
APLQETPEKQQRRTLSVENLHKEEEQQRGLGSNQMRRTFCMEQDASPALEATEENIMADD
LEPMDVDQSIHSVDKKSTGQLTEPQAVSEQQEHQPQLEQLPVQLKRPSIHADVPANVEEQ
KLSVKEQLSAGDEKEDVYVDHFGAMSPISDDIFKQPQCIGSLASLARGKKGSVTDEQFHD
AEFHDGASNNNNFDYLYTKGSNNAPPIDRSSLLLKFDPLLGAPVPVSQSQQQLQQQEQAL
LNILSNNNNLTRALSPTLEEHETSGSNQSLTFEPCAKGAAAAAQKDFKPPVDRTRKHAKM
SVDVIDNDCNKTFDNSNLNSEEKTNKYNNMDELEKKIKNEVTRSEDIEKKLKDAEQREEA
LVKRITEKDKTNAKLNGVIEAYEKAIAELIHDKEQLVQNHERQMLEVQTDRDSNYHHLTS
LETTFSDLHVKYEKSKEMTSQLKQIEENLLEEKKKLMDKLRQQEQRYEQMKSHAMQQMEI
ANKKMATLTKEHTDEVKKLKALLKKEEVSRISTAEQLQQKSRENADLLKICEELIYDKGQ
GGSS
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atggatttcctatcgaaactcataaagcgacccaacagcattgtgctgccagagaccgag
ccagcgcccgcacccggaccctcggccagttgcagttccagtgccccaacagctgtgccc
agctccaggccctctttatccagccccactgcgttcattacattagccatggatcgctgt
tccattgacccggaactggatagtctatttgattcagctgcccaggatttggatagcctg
gagcggcagcacaaagatttgatcgatcatgtggatgcgcctgttccatgtccagactct
gcacccaagtcaacaaacagcactagagaaaccatcaaacagctactcagtgagattaat
ttcaatctggatcaagtaaccgcacgtgaaatggaacatttacaggcaatgagccttgag
ctgagtccactggccgtaaagccaggtccggccaggcacagcttggagcagcagaaagcg
ctggtcgcggcaatgcgctccacatcgcagccgagcacgccgcgggacaaggagcagcca
ttgctcaagttcacgggtttgcccgagttcgacgagacccaaataccagaactggcgccg
ctcagcgtcgaaatggaagctcaactgaagtcggatgcatgtgctcctgtgctcagctcg
acaacgcttaagctgagcgagcacgaatacaactccgattccgatgtttatgccgagtgc
ctttccctgaacagcggcaagctctcggcggaccagtccgacctggaggcctactcgagc
gccttaaatgacgttctggagcagcagcaactgtccaatgtgacagcaacaacgctcgag
aatacgctgagcgatgcggctcataacaacagctgcgagccaatggatgtcgatgatatt
aatgagacaatggaattgctaaaggatgtgctcgcaccggaggaccgtcagcagctgcag
cagcagttgctggacggggcaatgcagcaggaagaggaggctcagcagccgacacagcaa
agggggatgccaaaagtagaggaacagcgggaggaggccgtgccaaaggagcagtccatg
cagcagaaagaagccgtgccaaaggagcagtccatgcagcaggacttaaagctggaacaa
tccttaaagctggaacaattctcaaagctgggacaatccatgctaaaggagcaggagaca
gccacgtcgcaaccaattgctgctccagctccaatatatccaaccgtacagcagacgatc
ccaattacggacctacagctggagcaactagtacccactgcttcagattcagacaaaatt
aaggatcatctaacgccgaatgcacaaaccgaatcgcagccagctcctgccccggctccg
ttatcaccaccattgcccacacaccagaagaagcaagatgtggagcaaccagtttcagac
tctgcagcttctgccccactctccccactgcagatacccgaagcagtgccagtctctgct
ccattgcagacgccagattctgtagagcaactgctggagcagcccattccacaatctgat
gcagctctaatcgcgcccacattgcaggcaccaccatgtcagctgttgcccacatcgccg
cccatacccacacatcgaatgaagacgcctgaggagctggtggagctgttggccttgcag
gtctacgcccagccacctgaagagccacagcaggaggcagacgtcatggcgagtgcagac
aggcacgtggacgagctgcaagcgttgccgcccaagcccgtggcaactgtggcgcccgta
cctaagcagcccagtccgttaccagcactagaactgaatataagtattggctcgcaaaat
ggctgctctgggccgatatcgcccagtttccctgtaagatcacctgcggaatcaccgagg
cactttccacgctcaccgcatgcgccggccgagcaggaggagatgcaatatctggaacag
gcgaacattgagcccgccgccgagcctaaactgtgcctgagcggagtcatagccaggtcg
ccgctacccatacaattgaccgtgacgggctccagccctgaggggccgctgcagcagccc
ctcgctgacaattccccactcaacggcacctttgacagcgccagtccggagtcgattgag
agagctggacgcccgtcgggggcaagttttggtgtggcgctaaatacagccggcggccag
caaagacgcaccttcttggtaagaacggatccagcagagcaacaggcggccaagcggctc
agcgattcccaagcgtatgatcgcggccaggaggaaaatcaattaaatgccacctatgcc
gcaccactgcaggaaactccggagaagcagcagcggcgcactctttccgtggagaatctg
cacaaggaggaggagcagcagcgcggattgggatcaaatcaaatgcgacgcactttttgc
atggagcaggacgcatcgccggcactagaggctaccgaggagaatatcatggctgatgat
ttggagcccatggatgtggatcagtcgatccacagcgtcgacaagaagtcgacaggacag
ctaaccgagcctcaagcagtttcagaacagcaagagcaccagccgcagctggagcagctg
cccgtccaactcaagcgtccgtctatccacgcagatgtgccagctaatgtcgaggagcaa
aagctgtctgttaaggagcagctcagtgccggcgatgaaaaggaggatgtctatgtggat
cactttggcgccatgtcgcccatttccgatgacatcttcaagcagccacagtgcatcggt
agcttggccagcttggccaggggcaagaaaggcagcgtaaccgatgagcaattccatgat
gcagagttccacgacggagccagcaacaacaacaatttcgattatttgtacacaaaaggc
agcaacaatgcgccgcccatcgatcggagctcgttactattgaaatttgatccgcttctg
ggtgctccggtaccagtaagtcagtcgcagcagcagctacagcagcaggagcaggcgctg
ctcaacatactcagcaacaacaacaatttaacacgtgcattgagtcccacattggaggag
cacgagaccagcggcagcaatcagtcgcttacatttgaaccctgtgccaaaggagcagca
gcggcagctcaaaaggatttcaagccgccagtggatagaacaagaaagcatgcaaaaatg
agtgtggatgttatcgataacgattgcaacaaaaccttcgataattcaaacctgaactcg
gaggaaaaaacaaacaaatacaacaacatggatgaactggagaaaaaaatcaaaaacgaa
gtcacccgctccgaggacattgaaaagaaacttaaagatgccgagcaacgcgaagaggcg
ctggtcaaacggattacagaaaaggacaaaacaaacgcaaaactcaacggcgtcattgag
gcctacgagaaagccattgcagagctgatccatgacaaggagcagctggtacaaaaccat
gaaaggcaaatgctggaagtgcaaacagatcgtgattcgaattatcatcacttaacgtcg
ctggaaacgacattctccgatctccatgtcaaatatgaaaagagcaaggagatgacctca
caactaaaacagatagaggagaatctgctggaggaaaagaagaaattaatggacaaattg
cgacagcaagagcagcgatatgagcaaatgaaaagccatgccatgcagcaaatggaaatt
gccaacaaaaagatggccacacttacaaaagagcacacggatgaggtgaaaaaattaaaa
gctttactcaaaaaggaggaagtctcgcgcatctcgacggctgagcagctgcaacaaaag
tcacgggagaatgcggatctgctcaagatatgcgaggagcttatctacgataagggacaa
ggtggtagtagttaa

DBGET integrated database retrieval system