KEGG   Drosophila virilis: Dvir_GJ10211Help
Entry
Dvir_GJ10211      CDS       T01066                                 

Definition
GJ10211 gene product from transcript GJ10211-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dvi  Drosophila virilis
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dvir_GJ10211
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dvir_GJ10211
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dvir_GJ10211
  Exosomal proteins of breast milk
   Dvir_GJ10211
Heparan sulfate/heparin binding proteins [BR:dvi00536]
 Enzymes (General comment) Variety
  Dvir_GJ10211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 376 aa AA seqDB search
MSPDELPISERHNSGNNSNNAGNMGQTADEQLLRLQDYNLLYNAERQTYFQLHSSNWRGT
NRPPPSGGNRLLQQVVGNTLSAAFGLNANDDNVKNTSMEMTTTQTVRLYDAASLRQSRFN
PFQPTRIIIHGWLGNAHANVYSYLVPAYMTLGDGNYNIFTVDWGRGAIADYITASYRVKP
VGQVLAKFLDFLHEEAGMRFEDLQLIGFSMGAHVAGLASKHLQTGRVRVIRALDPALPFF
RYAQEKERLSRSDADYVEVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWHECSHWRAF
ALFKESLEKMAFEAKGCETSEWQQLTRYKRCPQPTGQRLHMGGDLGELSMEQLAQRMGVY
YFETQAKAPYDMGAAL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgacgagctgccaatatcggaaaggcataattctggcaacaacagcaacaat
gcgggcaacatgggccaaacggctgatgagcaactattgcgattacaggactacaattta
ctgtacaatgccgagcggcagacatactttcagctgcactcgagcaattggcgtggcaca
aatagaccgccgccatcgggtggcaatcgactgttgcagcaggttgttggcaacacgctg
agcgccgcctttggcctgaatgcgaatgacgataatgttaagaatacttccatggagatg
accaccacgcaaacggtgcggctctatgatgccgcctccttgcgacaatcgcgcttcaac
ccattccaaccgacgcgcatcataatacacggctggctgggcaatgcacatgccaatgtc
tacagctatttggtccccgcctacatgaccctcggcgacggcaactacaatattttcacc
gtggactggggccgtggcgccattgccgactatataacggccagctatagggtgaagcct
gtgggtcaggtgctggccaagtttctggactttctgcacgaggaggctggcatgcggttt
gaggatctgcagctgattggcttcagcatgggcgcccatgtagctggcctggcctcaaaa
catttgcaaacgggccgcgtgcgtgtgatacgcgccttggatccagctttgccgtttttt
cgctatgcccaggagaaggagcgactgagtcgcagcgatgcggactatgtggaggtattg
cacacgagcgtgggaagctatggatttgatcgcccactgggccacgtggacttctatgcc
aattggggcagccagcagccgggctgcttttggcacgagtgcagccattggcgtgccttt
gccctcttcaaggagagcctggagaagatggccttcgaggccaagggttgtgagaccagt
gaatggcagcagttgacgcgctacaagcgctgtccacaacccacgggccaacggctgcac
atgggcggcgatttgggcgagttatcaatggagcagctggcgcagcgtatgggagtttat
tattttgagacccaggcgaaggcaccgtacgatatgggcgcagcattatag

DBGET integrated database retrieval system