KEGG   Drosophila virilis: Dvir_GJ10259Help
Entry
Dvir_GJ10259      CDS       T01066                                 

Definition
GJ10259 gene product from transcript GJ10259-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dvi  Drosophila virilis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dvir_GJ10259
   00670 One carbon pool by folate
    Dvir_GJ10259
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dvir_GJ10259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 186 aa AA seqDB search
MLRYNLIVAVCENFGIGLKGDLPWRLKSELKYFSRTTKRTRDPAKRNVVIMGRKTYFGVP
PSKRPLPDRLNIVLSTTMSRAELPNDVLLCRSLEEAMKMLESESEPWCDQIENIWIVGGS
GVYEEAMASPRCYRLYITKIQEQFECDTFFPNIPADFHEVPLDEDTPHGVQEENGIKYEY
KILEKQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggtataatttaattgttgcagtttgcgaaaactttggcattggcctcaagggc
gatctgccctggcgtctcaaatccgaactcaagtattttagtcgcacgacgaaacgcact
agagatcccgcgaagcgcaatgttgtcatcatgggccggaagacctattttggtgtaccg
cccagtaagcgaccgctgccagaccgcctgaacattgtgctcagcacgacgatgtctagg
gcagagctaccaaatgatgtgctgttgtgccgcagtctggaggaggcgatgaaaatgttg
gaaagtgaaagtgagccttggtgcgatcagatagagaacatttggattgtgggcggcagc
ggagtgtatgaggaggcgatggcatcgccgcgttgttatcgcctgtatattacgaaaatc
caagaacagttcgaatgcgacacattctttcccaatataccggcggattttcatgaggta
ccgctcgatgaggacacgccacatggtgtacaggaggagaacggtattaaatacgaatac
aaaatattggaaaaacaataa

DBGET integrated database retrieval system