KEGG   Drosophila virilis: Dvir_GJ10449Help
Entry
Dvir_GJ10449      CDS       T01066                                 

Definition
(RefSeq) GJ10449 gene product from transcript GJ10449-RD
  KO
K04437  
filamin
Organism
dvi  Drosophila virilis
Brite
Cytoskeleton proteins [BR:dvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dvir_GJ10449
  Intermediate filaments
   Intermediate filament-binding proteins
    Dvir_GJ10449
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dvir_GJ10449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2556 aa AA seqDB search
MYSDQQLVLVNGGTLNSNDTVGDERQRNTATIHNNRSQQQIGAVSPVAELVQNANYTNVN
GQAQTQATIYLNHNNNYRKNPPNLQNNVAAVAACVYNNCNNNNNFSNLSFYAQQPTSSYN
NNNNNNDDFELYQAVQPNDYYQQPQSEQYEENFDEDMEAERDLAEDAQWKKIQQNTFTRW
ANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRLPKYNKRPTFRSQKLENVSVALKF
LQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSGPTPKQR
LLNWIHARIPDMPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDPKDAVQNASEAMGL
ADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGI
EPIGPVVGAPANFTVETFSAGKGVVDVDIEGPNGVVEKADVRFNNDKNLTYTVSYIPKAE
GQHNVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPSGVTIKKPTFFDILTKDA
GRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFP
VKVAPLSDARKVRVSGRGLQATGVRVGDDADFKIHTEGAGEGVPEVRVIGPGGMNQNVMQ
SKVDGNTYECHYYPTKEGRYVVMVTFSGQEVPKSPFEVKVGPKKESSIVAYGPGLSSGVI
GYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNE
DIPKSPFIAHILPRTDFHPELVKASGPGLEKNGVTINQPASFDVDTSKAGNAPLDVIVQD
VYGNKLPVQIKNNPDGTKKVTYTPNSGVPHTVEVNYGGVSTPNSPHRIYVGVPVDASKVQ
AFGPWLQPGVRPNVPTHFNVDARDAGDAELKVKIVHEDTKLDVPCRIIDNQDSTYSVEVI
PPMKGAYTTTMTYGGQRVPLGDKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLP
KADLAVTITSPSGNRVKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCL
TGSDSNKVHAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTC
NVAYLPTEAGDYSVNITFNERHINGSPFQPLIVPLPNLKNTRVSGIGIQPHGVIMNADTD
FMVDMSKVGSNIESGKLSCAIFDPMGHVLPSKMVQGPTDDIFRIMYTPFEAGRHTIELMY
DNIPVPGSPFVVNVKSGCDPTRCKAYGPGLEKGLTNQKNKFTVETKGAGKGGLSLAIEGP
SEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYG
PGIEHGQVRESVPTVFNVDVGEAGPGRIAVKLTNSEGIPVDNLSVEDKGNCIYAVHYVPP
KAGSVLTCQVKFADVEVPCSPFVMTVFPKSEATKVTVKGVNEKKKTPASLPAEFEIDTKQ
AGQADINVAIKNPKGKPMQPRLEEVATGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKL
EAFPTGEAKKCKLVEQAPKIQPSGSQSHLKVDAREAGDGAVTCKITNKEGSEIVDIDVIE
KDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYVEEHTTKVVKQ
TTTQSELVNGKSEVTYRSVAFEKLPLPTTGGNVTAEVKMPSGKVDKPVIQDNRDGTVSVK
YDPREEGSHELVVKYNGEPVQGSPFRFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTK
GASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAK
ITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGIS
FTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGNGLKEGQTHSDNIFSV
DTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPF
TVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDA
EIQEVEDGLYSVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGL
ERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVG
LKFNDRHIPDSPFKVYISPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKI
VAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPA
AVHASGNGLDDIKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPL
LPGEHYITVKYNNMHIVGSPFRVHATGDKLADEGAQETSTVVVETVQKIAKGGKNTGVHL
PNFKSDASKVVSKGMGLKKAYIGKQNQFSICATDAGNNILYVGMYGPKGPCEEFHVKHAG
HNNYNVQYLVRDRGQYVLLIKWGEDHIPGSPFQIDV
NT seq 7671 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcgatcagcagttggtgttagttaacggtggtacgctcaacagtaacgacact
gtcggcgacgagcggcaaagaaacacagcgacaatccacaacaatcgaagccaacaacag
atcggtgcggtttcccctgttgctgaattagttcaaaacgcgaattatacaaacgtcaac
ggccaagcgcagacacaggcgacaatatatttaaatcacaacaacaactacagaaagaac
ccgccaaatttgcagaacaacgttgccgcagtcgccgcgtgtgtttataacaattgcaac
aacaacaacaattttagcaatttaagtttttacgcccagcagccaacgagcagctacaac
aacaacaacaacaacaacgacgacttcgagctctatcaagccgtgcagccgaacgactat
taccaacagcctcagtcggaacagtacgaagagaactttgacgaagatatggaggccgaa
cgtgatctagccgaggatgcgcaatggaagaaaatccaacagaataccttcacacgctgg
gccaacgagcatctgaagacgatcgatcgttccataaacaatctggaaacggatctgtct
gatggcctgcggctgattgccctcatcgaggtgctgtcgcagaagcgtttgcccaaatac
aataaacgtccaacattccgtagccagaaactggagaacgtgtcggtggccctgaaattc
ctacaggatgagggcatcaaaatcgttaatattgactcttcggacattgtcgactgcaag
ctgaagctgatattgggtctgatatggacgcttattctgcactactctatatcgatgccc
atgtgggatggcgaggatgagaagcaattgaatggctctggccccacgcccaagcagcgg
ctgttgaactggatacacgcccggatacccgatatgcccattaataacttcaccaatgac
tggacaactggcaaggcggtgggcgctttggtagatgcctgtgcgccaggcttgtgcccc
gactgggagatgtgggatcccaaagatgctgtgcagaatgcatcggaggccatgggtctg
gccgatgattggttgaatgtgcgtcagctgatcaagccggaggagctggtcaatcccaat
gtggatgagcagtccatgatgacatacctgtcgcaatatcccaactccaagctgaagacg
ggcgcaccactgcgtcccaagacgaatcccaatagagtgcgcgcctatggtcctggcatt
gaaccaattggccctgtggtgggcgcgcccgccaacttcaccgtcgaaaccttctccgca
ggcaaaggtgttgtcgatgtggacattgagggacccaacggtgtcgtggagaaggccgat
gtgcgcttcaacaatgacaagaatctcacatacaccgtttcgtatatacccaaggctgag
ggtcagcacaacgtggccgttaagttttcgggtcgtgatataccgaagtcgccgttcccc
gttaaggtcgagggtcatgctggcgatgcttccaaggtgaaggtaactggtcccggcatc
cagcctagcggtgtgaccatcaagaagccaaccttctttgacatactcaccaaggatgct
ggtcgcggtgtgcccgaggtgatcataattgatccggccaatcacaagacttcggtggct
gctaaggtgcgccagttggagaatgatacttggcgttgcgaatatgttaccgcactgcag
ggtctgcactcggttaatgtcttttacgcgggcacgcccataccgaatagccccttcccc
gtgaaggtggcaccgctgtcggatgcgcgtaaggtgcgtgtctccggccgcggcctgcag
gcgacgggcgtgcgtgttggcgacgatgccgatttcaaaatccataccgagggtgccggc
gagggtgtgccagaggtgcgcgtcattggacccggcggcatgaaccagaatgtcatgcaa
tccaaggtggatggcaatacctatgagtgccactattatcccaccaaggagggccgctat
gtggtgatggttacgtttagcggacaggaagtgcccaaatcgccgttcgaggtgaaggtg
ggtcccaagaaggaatcctcaattgttgcctatggccctggtctgagcagcggcgtcatt
ggatatcccgccgcctttgtggtggagaccaatggcgaaacgggcgcactcggcttcacc
gtagccggaccctcgcaagctgaaatcgaatgccatgacaatggtgatggctctgcattg
gtcaagtatcatccaactgccgtgggagagtatgctgtgcacatactctgcgacaacgag
gatatacccaagtcaccgtttatagctcacatactcccacgcaccgatttccatccggag
ctggttaaggccagtggtccgggtctggagaagaatggcgtaaccattaatcagccggct
agctttgatgtggataccagcaaagcgggtaacgccccactggatgttatcgtacaggat
gtctatggcaacaagttgcctgtgcagatcaagaataatcccgatggcaccaaaaaggtc
acctatacgcccaattccggcgtgccgcacactgtggaggtaaattatggtggcgtctca
acacccaattcgccgcatcgcatctatgtgggtgtgcccgtggatgcgtctaaggtgcaa
gcctttggcccctggctgcagccgggcgtgcgtcccaatgtgcccacccatttcaatgtg
gatgcacgcgatgctggcgatgcagagctcaaggtaaagatcgtgcacgaagacaccaaa
ctggatgtgccatgccgcatcattgataaccaggacagcacatattcggtcgaagtcatt
ccgcccatgaagggcgcctacaccacaaccatgacatatggcggtcaacgcgtgccactg
ggtgataaggtggtcgttgaacagacggtggatgtgtccaagatcaaggtggatggcctc
gagcccaccgcgcccctgaacagtttacagcagtttcgcattatcacccatggtctgccc
aaggcggatctggctgtgaccataacgagtccgtcgggcaatcgtgtgaaggcgcacatt
atacccaccgcggagggttttctggtcaactttacgcccacccagctgggtgaatatttg
ctgagcatctgctttggtggtacaccaataacgccacgccccttccgcctacaatgtttg
acgggcagtgattcgaataaggtgcacgccttcgggccgggcctagagcgtggaattgtc
ggccagccggctgagtttatgatagatacgcgtggcgctggccaaggcggcctgggcgtt
actgtcgagggtccctgcgaggcggccatcaattgccgggacaatggcgatggcacctgc
aatgtggcctatctgcccactgaggcgggcgattacagtgtcaacataacgtttaacgag
cgtcacatcaatggctccccattccagccgctgattgtgcccctgccgaatctgaagaat
acgcgcgtcagcggcatcggcatacagccgcatggtgtcatcatgaacgccgacacggac
tttatggtcgatatgagcaaggtgggcagcaatattgagtctggcaagctctcgtgcgcc
atctttgatccgatgggtcatgtgctgccgagtaaaatggtccagggacccaccgacgac
atcttccgcatcatgtacacacccttcgaggcgggacgtcacaccattgagctgatgtat
gataatatacctgtgcctgggtcgccgtttgttgtcaatgtgaagagtggatgtgatccg
acacgctgcaaggcctatggtccgggcttggagaagggtttgaccaatcagaagaacaag
ttcaccgtggagaccaagggcgccggcaagggtggcctatcgctggctattgaggggccc
tccgaggccaagatgacctgcacggacaaccgcgatggcagctgtgatgttgattatctg
gccactgatcccggcgagtatgatattaccatacgttttgcggataagcatatacccggc
tcaccgttccgtgtgctcgttgaggagacggtcgatcccagcaaggtgaaggtctacggg
ccgggcattgagcatggtcaggtgcgcgaaagtgtgcccaccgttttcaatgtggatgtg
ggcgaggctggtcctggccgcattgccgtcaagctgaccaactccgagggtatacccgtt
gacaatcttagcgtcgaggacaagggcaattgcatttatgcggttcactatgtgccgccc
aaggccggttccgtgctgacctgccaggtgaagttcgctgatgtggaggtgccatgcagc
ccgtttgtgatgaccgtttttccaaaatccgaggcgacaaaagtcaccgtgaagggcgtc
aatgagaagaagaaaacacccgcctcactgccagccgaatttgagattgatacgaagcaa
gccggccaggcggacattaatgtggccatcaagaatccaaagggcaagccaatgcagcca
cgcctcgaggaggtggccaccggcacctatgtggtatcgtttgtgccggacgagtgcggc
acctatcagtgcagcatcaagtatggcgacaaggagatcgagggctcacccttcaaactc
gaagcattccccaccggcgaggccaagaaatgcaaactggtggagcaggcgcccaaaata
cagccatccggtagtcagtcccatctgaaggtggatgcacgcgaagcgggcgatggagct
gttacctgcaagataaccaacaaggaaggcagtgaaattgtggacattgatgttatcgag
aaggatggcttctttgacatactgtatgccctgaacgaccctggagattacgatattaat
gtcaagttcggcggcaaggacataccgaatggcagcttctccattaaggctgtcgaaagc
atcgaacaatactcgcacagtgaatacgtcgaggagcatacgaccaaagtggttaagcag
acaacaacacagagcgaactggtcaacggcaaatcggaagttacatatcgaagtgtcgcc
tttgagaaattgccactacccacaacaggcggaaacgttactgctgaagtcaaaatgcca
agtggtaaggtagataaacctgttattcaggataaccgtgatggtaccgtctccgtgaag
tatgatccacgcgaggagggctcccacgagctggttgttaaatacaatggcgaacccgtg
caaggctctccattcagattccatgtggactctataacatccggctatgtgaccgcctat
ggaccgggcttgacgcacggcgtcactggcgagccagccaactttaccatctccaccaag
ggtgccagcgccggtggcctgaccatggccgttgaaggacccagcaaggcagacatcaac
tatcatgacaacaaagacggcaccgtttcggtgcaatatctgcccactgcaccgggcgag
taccaggtttcggtgcgtttcggtgataagcatatcaagggctcaccctatttcgccaag
ataacgggcgaaggtcgcaaacgtaatcagatatcggttggctcctgctcggaggtgacc
atgcccggcgacattaccgacgatgatctgcgcgctctaaatgcctccattcaggcaccc
agcggcctggaggagccgtgcttcctcaagcgcatgcccaccggcaacattggtatttcg
tttacgccacgtgaaattggcgagcatctggtgtcagtgaagcgtctgggcaagcacatc
aacaactcccccttcaaggtcaccgtctgcgagcgcgaagtgggtgatgcaaagaaggtg
aaggtcagcggtaacggcctcaaggagggacagacgcacagcgacaacattttctccgtt
gacacacgcaatgccggctttggtggtctctctgtgtccatcgagggtcccagcaaggcg
gagattcagtgcaccgacaaggatgacggcacactaaacatctcctacaagcccactgag
cccggctactacattgtcaatcttaagtttgctgatcatcatgtggagggctcgcccttc
accgtcaaggtcgccggcgaaggcagcaaccggaagcgcgagaagattcagcgcgaacgt
gatgcagtgcccatcaccgaaattggcagccagtgcaagctgactttcaaaatgcccggc
atcacgtccttcgatctggccgcctgcgtcacctcgcccagcaatgtcaccgaggatgct
gagatccaagaagttgaggatggtctctactctgtgcactttgtgcccaaggaactgggc
gtgcacaccgtttcggtgcgctactctgagatgcacatacccggctcacccttccagttc
acggtgggtccactacgtgattcgggcagccatttggtaaaggctggcggctccggtcta
gaacgcggcgttgtcggtgaggcagccgaatttaatgtgtggacacgtgaagctggtggc
ggttcgctggccatttcggtggagggtcccagcaaggcagacattgaattcaaggatcgc
aaggacggcagctgcgatgtctcctataaggtgaccgagcctggagagtatcgtgtgggt
cttaagtttaacgaccgccacatcccagactcgccattcaaggtctacatctcgcccgat
gccggcgatgcccacaagctggaggtgcagcaattcccacagggcaacatccaggccgat
gcgccctaccagtttatggtgcgcaagaacggcgccaagggtgagctggatgccaagatt
gtggctccctcgggcaccgatgatgattgcttcattcaggtgatcgacggtgaaatgtat
tcggtgcgtttctatccacgtgagaatggcatccatgcgattcacgttaagttcaatggt
gtccacatacccgactcaccgttcagaattaaggtaggcaaggatgtggccgatccggct
gccgtgcatgccagcggcaatggtctggacgacatcaagactggccacaaggccgatttc
atcatcaacacctgcaatgcgggcgttggcacactggccgtttccatcgatggtccatcc
aaggtggccatggactgcacagaagttgaggagggctacaaggtgcgctacacaccgctg
ctgccgggcgagcactacatcacggttaaatacaacaacatgcatattgtgggctcaccc
ttcagggtacatgccaccggcgacaagctggccgatgagggagcccaggaaacgtccaca
gttgttgtggagaccgtccaaaagatcgcgaagggtggcaagaatactggcgtccatctg
cccaacttcaagtccgatgccagcaaggtggtgtccaagggaatgggcttgaagaaggcg
tacattggcaagcagaatcagttcagcatctgcgctacagatgcgggcaataacatcttg
tacgtgggcatgtacggacccaagggaccctgcgaggagttccatgtgaagcatgctggc
cacaacaactacaatgtgcagtatctggtgcgcgatcgcggacagtatgtgctccttatt
aaatggggcgaagaccatatacccggctccccattccagatcgatgtctag

DBGET integrated database retrieval system