KEGG   Drosophila virilis: Dvir_GJ10449Help
Entry
Dvir_GJ10449      CDS       T01066                                 

Definition
GJ10449 gene product from transcript GJ10449-RA
Orthology
K04437  
filamin
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1450 aa AA seqDB search
MIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYSVNITFNERHINGS
PFQPLIVPLPNLKNTRVSGIGIQPHGVIMNADTDFMVDMSKVGSNIESGKLSCAIFDPMG
HVLPSKMVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPTRCKAY
GPGLEKGLTNQKNKFTVETKGAGKGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGE
YDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTVFNVDVGEAGPG
RIAVKLTNSEGIPVDNLSVEDKGNCIYAVHYVPPKAGSVLTCQVKFADVEVPCSPFVMTV
FPKSEATKVTVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKPMQPRLEEVA
TGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQPSGSQ
SHLKVDAREAGDGAVTCKITNKEGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGK
DIPNGSFSIKAVESIEQYSHSEYVEEHTTKVVKQTTTQSELVNGKSEVTYRSVAFEKLPL
PTTGGNVTAEVKMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFR
FHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKD
GTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDIT
DDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFK
VTVCEREVGDAKKVKVSGNGLKEGQTHSDNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTD
KDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPIT
EIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYSVHFVPKELGVHTVSV
RYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAIS
VEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYISPDAGDAHK
LEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYP
RENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDDIKTGHKADFIINTCN
AGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFRVHAT
GDKLADEGAQETSTVVVETVQKIAKGGKNTGVHLPNFKSDASKVVSKGMGLKKAYIGKQN
QFSICATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEDH
IPGSPFQIDV
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atgatagatacgcgtggcgctggccaaggcggcctgggcgttactgtcgagggtccctgc
gaggcggccatcaattgccgggacaatggcgatggcacctgcaatgtggcctatctgccc
actgaggcgggcgattacagtgtcaacataacgtttaacgagcgtcacatcaatggctcc
ccattccagccgctgattgtgcccctgccgaatctgaagaatacgcgcgtcagcggcatc
ggcatacagccgcatggtgtcatcatgaacgccgacacggactttatggtcgatatgagc
aaggtgggcagcaatattgagtctggcaagctctcgtgcgccatctttgatccgatgggt
catgtgctgccgagtaaaatggtccagggacccaccgacgacatcttccgcatcatgtac
acacccttcgaggcgggacgtcacaccattgagctgatgtatgataatatacctgtgcct
gggtcgccgtttgttgtcaatgtgaagagtggatgtgatccgacacgctgcaaggcctat
ggtccgggcttggagaagggtttgaccaatcagaagaacaagttcaccgtggagaccaag
ggcgccggcaagggtggcctatcgctggctattgaggggccctccgaggccaagatgacc
tgcacggacaaccgcgatggcagctgtgatgttgattatctggccactgatcccggcgag
tatgatattaccatacgttttgcggataagcatatacccggctcaccgttccgtgtgctc
gttgaggagacggtcgatcccagcaaggtgaaggtctacgggccgggcattgagcatggt
caggtgcgcgaaagtgtgcccaccgttttcaatgtggatgtgggcgaggctggtcctggc
cgcattgccgtcaagctgaccaactccgagggtatacccgttgacaatcttagcgtcgag
gacaagggcaattgcatttatgcggttcactatgtgccgcccaaggccggttccgtgctg
acctgccaggtgaagttcgctgatgtggaggtgccatgcagcccgtttgtgatgaccgtt
tttccaaaatccgaggcgacaaaagtcaccgtgaagggcgtcaatgagaagaagaaaaca
cccgcctcactgccagccgaatttgagattgatacgaagcaagccggccaggcggacatt
aatgtggccatcaagaatccaaagggcaagccaatgcagccacgcctcgaggaggtggcc
accggcacctatgtggtatcgtttgtgccggacgagtgcggcacctatcagtgcagcatc
aagtatggcgacaaggagatcgagggctcacccttcaaactcgaagcattccccaccggc
gaggccaagaaatgcaaactggtggagcaggcgcccaaaatacagccatccggtagtcag
tcccatctgaaggtggatgcacgcgaagcgggcgatggagctgttacctgcaagataacc
aacaaggaaggcagtgaaattgtggacattgatgttatcgagaaggatggcttctttgac
atactgtatgccctgaacgaccctggagattacgatattaatgtcaagttcggcggcaag
gacataccgaatggcagcttctccattaaggctgtcgaaagcatcgaacaatactcgcac
agtgaatacgtcgaggagcatacgaccaaagtggttaagcagacaacaacacagagcgaa
ctggtcaacggcaaatcggaagttacatatcgaagtgtcgcctttgagaaattgccacta
cccacaacaggcggaaacgttactgctgaagtcaaaatgccaagtggtaaggtagataaa
cctgttattcaggataaccgtgatggtaccgtctccgtgaagtatgatccacgcgaggag
ggctcccacgagctggttgttaaatacaatggcgaacccgtgcaaggctctccattcaga
ttccatgtggactctataacatccggctatgtgaccgcctatggaccgggcttgacgcac
ggcgtcactggcgagccagccaactttaccatctccaccaagggtgccagcgccggtggc
ctgaccatggccgttgaaggacccagcaaggcagacatcaactatcatgacaacaaagac
ggcaccgtttcggtgcaatatctgcccactgcaccgggcgagtaccaggtttcggtgcgt
ttcggtgataagcatatcaagggctcaccctatttcgccaagataacgggcgaaggtcgc
aaacgtaatcagatatcggttggctcctgctcggaggtgaccatgcccggcgacattacc
gacgatgatctgcgcgctctaaatgcctccattcaggcacccagcggcctggaggagccg
tgcttcctcaagcgcatgcccaccggcaacattggtatttcgtttacgccacgtgaaatt
ggcgagcatctggtgtcagtgaagcgtctgggcaagcacatcaacaactcccccttcaag
gtcaccgtctgcgagcgcgaagtgggtgatgcaaagaaggtgaaggtcagcggtaacggc
ctcaaggagggacagacgcacagcgacaacattttctccgttgacacacgcaatgccggc
tttggtggtctctctgtgtccatcgagggtcccagcaaggcggagattcagtgcaccgac
aaggatgacggcacactaaacatctcctacaagcccactgagcccggctactacattgtc
aatcttaagtttgctgatcatcatgtggagggctcgcccttcaccgtcaaggtcgccggc
gaaggcagcaaccggaagcgcgagaagattcagcgcgaacgtgatgcagtgcccatcacc
gaaattggcagccagtgcaagctgactttcaaaatgcccggcatcacgtccttcgatctg
gccgcctgcgtcacctcgcccagcaatgtcaccgaggatgctgagatccaagaagttgag
gatggtctctactctgtgcactttgtgcccaaggaactgggcgtgcacaccgtttcggtg
cgctactctgagatgcacatacccggctcacccttccagttcacggtgggtccactacgt
gattcgggcagccatttggtaaaggctggcggctccggtctagaacgcggcgttgtcggt
gaggcagccgaatttaatgtgtggacacgtgaagctggtggcggttcgctggccatttcg
gtggagggtcccagcaaggcagacattgaattcaaggatcgcaaggacggcagctgcgat
gtctcctataaggtgaccgagcctggagagtatcgtgtgggtcttaagtttaacgaccgc
cacatcccagactcgccattcaaggtctacatctcgcccgatgccggcgatgcccacaag
ctggaggtgcagcaattcccacagggcaacatccaggccgatgcgccctaccagtttatg
gtgcgcaagaacggcgccaagggtgagctggatgccaagattgtggctccctcgggcacc
gatgatgattgcttcattcaggtgatcgacggtgaaatgtattcggtgcgtttctatcca
cgtgagaatggcatccatgcgattcacgttaagttcaatggtgtccacatacccgactca
ccgttcagaattaaggtaggcaaggatgtggccgatccggctgccgtgcatgccagcggc
aatggtctggacgacatcaagactggccacaaggccgatttcatcatcaacacctgcaat
gcgggcgttggcacactggccgtttccatcgatggtccatccaaggtggccatggactgc
acagaagttgaggagggctacaaggtgcgctacacaccgctgctgccgggcgagcactac
atcacggttaaatacaacaacatgcatattgtgggctcacccttcagggtacatgccacc
ggcgacaagctggccgatgagggagcccaggaaacgtccacagttgttgtggagaccgtc
caaaagatcgcgaagggtggcaagaatactggcgtccatctgcccaacttcaagtccgat
gccagcaaggtggtgtccaagggaatgggcttgaagaaggcgtacattggcaagcagaat
cagttcagcatctgcgctacagatgcgggcaataacatcttgtacgtgggcatgtacgga
cccaagggaccctgcgaggagttccatgtgaagcatgctggccacaacaactacaatgtg
cagtatctggtgcgcgatcgcggacagtatgtgctccttattaaatggggcgaagaccat
atacccggctccccattccagatcgatgtctag

DBGET integrated database retrieval system