KEGG   Drosophila virilis: Dvir_GJ10450Help
Entry
Dvir_GJ10450      CDS       T01066                                 

Definition
GJ10450 gene product from transcript GJ10450-RA
Orthology
K04437  
filamin
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1031 aa AA seqDB search
MYSDQQLVLVNGGTLNSNDTVGDERQRNTATIHNNRSQQQIGAVSPVAELVQNANYTNVN
GQAQTQATIYLNHNNNYRKNPPNLQNNVAAVAACVYNNCNNNNNFSNLSFYAQQPTSSYN
NNNNNNDDFELYQAVQPQSEQYEENFDEDMEAERDLAEDAQWKKIQQNTFTRWANEHLKT
IDRSINNLETDLSDGLRLIALIEVLSQKRLPKYNKRPTFRSQKLENVSVALKFLQDEGIK
IVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSGPTPKQRLLNWIHA
RIPDMPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDPKDAVQNASEAMGLADDWLNV
RQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVV
GAPANFTVETFSAGKGVVDVDIEGPNGVVEKADVRFNNDKNLTYTVSYIPKAEGQHNVAV
KFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPSGVTIKKPTFFDILTKDAGRGVPEV
IIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLS
DARKVRVSGRGLQATGVRVGDDADFKIHTEGAGEGVPEVRVIGPGGMNQNVMQSKVDGNT
YECHYYPTKEGRYVVMVTFSGQEVPKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFV
VETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF
IAHILPRTDFHPELVKASGPGLEKNGVTINQPASFDVDTSKAGNAPLDVIVQDVYGNKLP
VQIKNNPDGTKKVTYTPNSGVPHTVEVNYGGVSTPNSPHRIYVGVPVDASKVQAFGPWLQ
PGVRPNVPTHFNVDARDAGDAELKVKIVHEDTKLDVPCRIIDNQDSTYSVEVIPPMKGAY
TTTMTYGGQRVPLGDKVVVEQTVDVSKIKVDGLEPSGSGCDHNESVGQSCEGAHYTHRGG
FSGQLYAHPAG
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcgatcagcagttggtgttagttaacggtggtacgctcaacagtaacgacact
gtcggcgacgagcggcaaagaaacacagcgacaatccacaacaatcgaagccaacaacag
atcggtgcggtttcccctgttgctgaattagttcaaaacgcgaattatacaaacgtcaac
ggccaagcgcagacacaggcgacaatatatttaaatcacaacaacaactacagaaagaac
ccgccaaatttgcagaacaacgttgccgcagtcgccgcgtgtgtttataacaattgcaac
aacaacaacaattttagcaatttaagtttttacgcccagcagccaacgagcagctacaac
aacaacaacaacaacaacgacgacttcgagctctatcaagccgtgcagcctcagtcggaa
cagtacgaagagaactttgacgaagatatggaggccgaacgtgatctagccgaggatgcg
caatggaagaaaatccaacagaataccttcacacgctgggccaacgagcatctgaagacg
atcgatcgttccataaacaatctggaaacggatctgtctgatggcctgcggctgattgcc
ctcatcgaggtgctgtcgcagaagcgtttgcccaaatacaataaacgtccaacattccgt
agccagaaactggagaacgtgtcggtggccctgaaattcctacaggatgagggcatcaaa
atcgttaatattgactcttcggacattgtcgactgcaagctgaagctgatattgggtctg
atatggacgcttattctgcactactctatatcgatgcccatgtgggatggcgaggatgag
aagcaattgaatggctctggccccacgcccaagcagcggctgttgaactggatacacgcc
cggatacccgatatgcccattaataacttcaccaatgactggacaactggcaaggcggtg
ggcgctttggtagatgcctgtgcgccaggcttgtgccccgactgggagatgtgggatccc
aaagatgctgtgcagaatgcatcggaggccatgggtctggccgatgattggttgaatgtg
cgtcagctgatcaagccggaggagctggtcaatcccaatgtggatgagcagtccatgatg
acatacctgtcgcaatatcccaactccaagctgaagacgggcgcaccactgcgtcccaag
acgaatcccaatagagtgcgcgcctatggtcctggcattgaaccaattggccctgtggtg
ggcgcgcccgccaacttcaccgtcgaaaccttctccgcaggcaaaggtgttgtcgatgtg
gacattgagggacccaacggtgtcgtggagaaggccgatgtgcgcttcaacaatgacaag
aatctcacatacaccgtttcgtatatacccaaggctgagggtcagcacaacgtggccgtt
aagttttcgggtcgtgatataccgaagtcgccgttccccgttaaggtcgagggtcatgct
ggcgatgcttccaaggtgaaggtaactggtcccggcatccagcctagcggtgtgaccatc
aagaagccaaccttctttgacatactcaccaaggatgctggtcgcggtgtgcccgaggtg
atcataattgatccggccaatcacaagacttcggtggctgctaaggtgcgccagttggag
aatgatacttggcgttgcgaatatgttaccgcactgcagggtctgcactcggttaatgtc
ttttacgcgggcacgcccataccgaatagccccttccccgtgaaggtggcaccgctgtcg
gatgcgcgtaaggtgcgtgtctccggccgcggcctgcaggcgacgggcgtgcgtgttggc
gacgatgccgatttcaaaatccataccgagggtgccggcgagggtgtgccagaggtgcgc
gtcattggacccggcggcatgaaccagaatgtcatgcaatccaaggtggatggcaatacc
tatgagtgccactattatcccaccaaggagggccgctatgtggtgatggttacgtttagc
ggacaggaagtgcccaaatcgccgttcgaggtgaaggtgggtcccaagaaggaatcctca
attgttgcctatggccctggtctgagcagcggcgtcattggatatcccgccgcctttgtg
gtggagaccaatggcgaaacgggcgcactcggcttcaccgtagccggaccctcgcaagct
gaaatcgaatgccatgacaatggtgatggctctgcattggtcaagtatcatccaactgcc
gtgggagagtatgctgtgcacatactctgcgacaacgaggatatacccaagtcaccgttt
atagctcacatactcccacgcaccgatttccatccggagctggttaaggccagtggtccg
ggtctggagaagaatggcgtaaccattaatcagccggctagctttgatgtggataccagc
aaagcgggtaacgccccactggatgttatcgtacaggatgtctatggcaacaagttgcct
gtgcagatcaagaataatcccgatggcaccaaaaaggtcacctatacgcccaattccggc
gtgccgcacactgtggaggtaaattatggtggcgtctcaacacccaattcgccgcatcgc
atctatgtgggtgtgcccgtggatgcgtctaaggtgcaagcctttggcccctggctgcag
ccgggcgtgcgtcccaatgtgcccacccatttcaatgtggatgcacgcgatgctggcgat
gcagagctcaaggtaaagatcgtgcacgaagacaccaaactggatgtgccatgccgcatc
attgataaccaggacagcacatattcggtcgaagtcattccgcccatgaagggcgcctac
accacaaccatgacatatggcggtcaacgcgtgccactgggtgataaggtggtcgttgaa
cagacggtggatgtgtccaagatcaaggtggatggcctcgagcccagcggatctggctgt
gaccataacgagtccgtcgggcaatcgtgtgaaggcgcacattatacccaccgcggaggg
ttttctggtcaactttacgcccacccagctgggtga

DBGET integrated database retrieval system