KEGG   Drosophila virilis: Dvir_GJ10482Help
Entry
Dvir_GJ10482      CDS       T01066                                 

Definition
GJ10482 gene product from transcript GJ10482-RA
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dvi  Drosophila virilis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dvi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dvi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dvi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dvi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 354 aa AA seqDB search
MPMANSTRLSSSSVLATESSNKGMIIINRPKALNAINLEMVRKIYKHLKKCEKSKSLMII
KGTGDKAFCAGGDVRALVDAGPTDESKSFFREEYTANALIGNYKIPYIALIDGITMGGGV
GLSVHGKYRVATDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGHRLRGADVY
YAGIATHYCEGSKIAELEQALLNCPDADEVPDILQRFHCQPEKPFSLQPVLEQINKHFSA
SSVEGILESLQNDDSDWAKKQLEILCKVSPTSLKVTFRQLELGAQMSLAQCLIMEYRLAV
RHLEPRADFKEGVRALLIDKDQKPKWQPATLAEVTEEHLQWFFNKLPDTEELKL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggcaaactccacgcgcctctcctcatcctccgtgctggccacggaatcatcc
aacaagggcatgatcattataaacaggccaaaggccttgaatgccatcaatcttgagatg
gtgcgcaagatatacaagcatctgaaaaaatgtgaaaagtcgaaatcgctgatgattatc
aagggtactggtgataaagccttctgtgcgggcggcgatgtgcgtgcgctggttgatgcc
ggacccacggatgaatcaaagagcttctttcgagaggagtacacagccaatgcattgatt
ggcaactacaagataccctacattgcactcatcgatggcattaccatgggcggcggcgtt
ggactcagcgtccatggaaaatatcgtgtggctaccgatcgtacgttgttcgccatgccc
gagacggccattggactgtttccggatgtgggcggttcatatttcttgccacgcctccag
ggaaaacttggcttgtatttgggcctgacaggccatcgattacgtggcgccgatgtctat
tatgcgggcattgccacacattactgcgagggcagcaaaatagccgaactggaacaagca
ctgctcaactgcccggatgccgatgaagtgcctgacatactgcaaaggttccactgccag
ccggagaaaccattctccttacagcccgtgctggagcagattaacaagcacttttcggcc
agctccgtagagggaatacttgagagtctgcagaacgatgacagcgattgggcgaagaaa
cagttagagatcctttgcaaagtgtcgccgacatccctgaaggtaacctttcgccagctg
gagcttggcgcacagatgtcgctggcccaatgcttgatcatggaatatcgcctcgctgtg
cgccatttggagccgcgcgctgacttcaaggagggtgttcgcgcactcctcatcgacaag
gatcaaaagcccaaatggcaaccagccacgctagccgaggtcaccgaggagcatttgcaa
tggttcttcaacaaactgcccgacaccgaggagctcaaattgtaa

DBGET integrated database retrieval system