KEGG   Drosophila virilis: Dvir_GJ10501Help
Entry
Dvir_GJ10501      CDS       T01066                                 

Definition
GJ10501 gene product from transcript GJ10501-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dvi  Drosophila virilis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dvi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 623 aa AA seqDB search
MPPVLDIVVVVIVVRPASCTADDHGLSYRHITALQGMPRRTWAATVQPPPVIQTLSTAGS
GSGSGSDSDSDSGIGPEFRLVADKESVLEDATFWRRVGLKQLGKIIEKAKRAKENSYQHK
AKNIIIFIGDGMGLSTISAGRIYKGQYLKHGHGEEEMLSFDEFPHTGLAKTYNVDKQVPD
SAGTATAIFTGVKSDYGAIGMDTTRSKLNASQGRLDSIMDWAQREGKRTGVVTTTRITHA
TPAATFARVYHRDWECDTEVPQESIGIHADIARQLVENAPGNRLNVVLGGGLSPMGAFNE
SEVQTVQFEGGTETICKRNDERNLAKEWLQRHANDSADAALVYTREQLMKVDVEEVDHLM
GLFRNNHITYSIAREQGEPSLKEMTETAIGVLERGKQSPGYVLLVEGGRIDQGHHQNYAR
AALHEVYELDLAVQAALKMTDSEETLILVTADHSHSVTFNGYPERGADILGAANSHKPKD
PMVYETITYANGPGYFDHLANETKPANSSNVWMPLKLYTKEQTESPTYRHMATLALKDET
HGGEDVIVFASGPGSSLVRGVFEQNYLAYVMSYAGCMGPAKNFDDSCKRHLSTAGSNKAE
SSAAALRLSLLPLLAAWLIAHLL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggttctagacatcgtcgtcgtcgtcatcgtcgtgcggcccgcttcgtgcaca
gccgatgatcatggcctatcgtaccgccatataacggcgcttcagggcatgccgagacgc
acttgggcggccacagtgcagccgccgcccgtgatacaaaccctgagcaccgcgggcagc
ggcagcggcagcggcagcgacagcgacagcgacagcggcattggaccagagttcaggctg
gtggcggacaaggagagcgttttggaagatgcaacattctggcggcgagtgggccttaag
cagctgggtaaaataatagaaaaggcaaagcgcgccaaggaaaactcatatcagcacaag
gccaagaacattatcatctttattggcgatggcatgggcttgtccacgatcagtgccgga
cgcatctacaagggccagtacctaaagcatggacatggcgaggaggaaatgctgtccttt
gatgagttcccccacacgggcctggccaagacctacaatgtggataaacaggtgccggac
tcggcgggcacagctacagccatattcacgggtgtcaagagcgactatggcgccattggc
atggacaccacacgctccaagttgaacgccagccagggtcgactcgactccatcatggac
tgggcacagcgtgaaggcaaacgcactggcgtggtgaccaccacacgcattacgcacgcc
acgcccgcagccacctttgcgcgtgtctatcatcgggactgggagtgcgacacggaggtg
ccacaggagtccattggcatacatgcggacattgcacgccagctggttgagaatgcgcct
ggcaacaggctaaacgtggtgctaggtggtggcctatcgcccatgggcgctttcaacgag
agcgaggtgcagaccgtccaattcgagggcggcaccgaaaccatctgcaagcgtaacgat
gagcgcaatctggccaaggagtggctgcagcggcacgccaacgacagtgccgacgcagcg
ctggtgtacacacgcgaacagctgatgaaggtggatgtggaggaggtggatcatttgatg
ggcttgtttcggaacaatcacatcacctactccatagcacgcgaacagggcgaaccatcg
ttgaaggagatgaccgagacggccatcggtgtgctggagcgtggcaagcagtcgccgggc
tatgtgctactcgtggagggcggacgcattgatcagggtcatcatcagaattatgcacgt
gctgccctgcacgaggtctacgaactggatctggccgtgcaagcggctctaaagatgacc
gattcggaggagacgctcattctggtcacagcggatcattcgcattcggtcaccttcaat
ggttatccggaacgcggcgctgatattttgggcgccgccaattcacacaagcctaaggat
cccatggtatatgagaccataacgtatgccaatggacccggctacttcgaccatttggcg
aatgaaacaaagccggcaaacagctccaatgtgtggatgccactcaagctgtacaccaag
gagcagaccgaatcccccacctatcgccacatggccacgctggcgctcaaggatgaaacg
catggcggcgaggatgtgattgtctttgccagcggccccggttctagtctggtgcgcggc
gtcttcgagcaaaactatttggcctacgttatgagctatgccggctgcatgggtcccgcc
aagaattttgatgattcctgcaagcgccatctgtcgacagctggcagcaacaaggccgaa
agcagcgccgccgctctgagactctcgctgcttccgctgctggccgcttggctgatcgcg
catctgctttaa

DBGET integrated database retrieval system