KEGG   Drosophila virilis: Dvir_GJ10721Help
Entry
Dvir_GJ10721      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 ASL_C
Motif
Other DBs
NCBI-GeneID: 6632714
NCBI-ProteinID: XP_015026037
FlyBase: FBgn0197998
UniProt: A0A0Q9W0T4
Position
Unknown
AA seq 533 aa AA seqDB search
MQHVLGIYVNNTMLEVDRMMEQCGDLSRQQLILLLLSPLITLLSAVHFRSYSILNTVPKY
WCADGLESGARPPNESSCKPLYNNATHSSSCKKYNYEHYMGYQSFVSEMNWICDQEDKLS
KGDSVYLAGCLIGCLVMGYLADRLGRVPILVLAKVVTIFGNFLTIFGMSLALYCIFRFIT
GFVINSNFFLIRILIVEYMRPSLHTVCLNICYGFFLFLGMVSTPWITILLGTWRRFMLLE
MVSIIMVPIFFYFVPESVQWLISRKKYGQAITALKRVAKINGRQIDDRVYEEFIEDCKLS
QQNAKKHPNLLDLFKTPHLRRTYLIMLFEFMVLPYYCKLLVYYVRGFKISPFVMSSLRAA
PILPASLVIIIVQDRIGRKALAMTIRFLIVLFLLLSSIFLSHAANRLLFTFFVIGIFFCN
LAFHSNMQYAIELIPTCVRGQALGAIYDVDLMYIICIKYILNTSADFLSLPEIILGVLTL
LGACLFLLLPETLNRTLPCSLEDGEKLGNDEHWYTFGCTKKRTQPEELNSLAQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgtgcttggaatatatgtaaataacacaatgttggaagtggacagaatgatg
gaacaatgcggtgatttaagtaggcagcagctaatcttgctgttactctctcctttgatc
actctactatcagccgtgcatttccgatcctattcgatccttaatactgtgccaaagtat
tggtgtgctgatgggctggagtcgggggcacgaccaccaaatgaatccagctgcaaacca
ctgtacaataatgcaacacactcaagctcctgcaaaaagtacaactatgagcattatatg
ggttatcagagttttgtcagtgaaatgaactggatatgtgatcaagaggataaacttagc
aagggagactccgtgtaccttgcgggttgcttgataggctgtctagttatgggctatttg
gctgatagattgggtcgtgtgcccattcttgttttggccaaggttgtcaccatattcggc
aactttttgacaatctttggcatgagtctggcactttattgtatatttagatttattacc
ggcttcgtaattaacagcaacttttttcttatccgaattctaattgtggaatatatgcgt
ccttctttgcacaccgtttgcctaaacatctgctacggtttctttttatttttgggcatg
gtaagcacaccttggataaccatcctcttgggtacttggcgtcgtttcatgcttctcgaa
atggtgtcaataattatggtgccgattttcttttattttgtaccggagagcgtgcaatgg
ctgatctcaaggaagaaatatggccaggctataaccgccctaaagcgtgtggccaagata
aatggccgccaaattgatgacagggtctatgaggaattcattgaagactgcaaattaagt
caacaaaatgcgaagaaacacccaaatctgcttgacctcttcaagacaccgcacctacgc
cgcacctatttaataatgttgtttgaattcatggtacttccctactactgtaaactcttg
gtttattatgtgcgtggctttaagatttcgccatttgtaatgtcctcattgcgggcagct
cctattctgcctgcttccttggtaataattatcgtgcaagatcgcataggacgtaaggcg
ttggctatgacaatacggttccttattgtccttttcctcttgctatcgagcatcttcctc
tcgcatgctgctaatcgcttactattcacgtttttcgtaattgggatttttttttgcaac
cttgccttccattcgaatatgcagtatgccattgagctgattccaacatgtgtgcgtggc
caggcattgggtgccatctatgatgtagaccttatgtacataatatgcataaaatacata
ttgaacacgtctgcagacttcttgtcgttgccggaaatcattctgggcgtgctcactctg
ctaggtgcctgcttgttcttgctgctgccggagacactgaatcgcactctgccctgctca
ctggaggatggcgagaagcttggcaatgacgagcattggtacacatttgggtgcacgaag
aagcgcacgcagccggaagagcttaatagcttggctcaataa

DBGET integrated database retrieval system