KEGG   Drosophila virilis: Dvir_GJ10721Help
Entry
Dvir_GJ10721      CDS       T01066                                 

Definition
(RefSeq) GJ10721 gene product from transcript GJ10721-RB
Organism
dvi  Drosophila virilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 533 aa AA seqDB search
MQHVLGIYVNNTMLEVDRMMEQCGDLSRQQLILLLLSPLITLLSAVHFRSYSILNTVPKY
WCADGLESGARPPNESSCKPLYNNATHSSSCKKYNYEHYMGYQSFVSEMNWICDQEDKLS
KGDSVYLAGCLIGCLVMGYLADRLGRVPILVLAKVVTIFGNFLTIFGMSLALYCIFRFIT
GFVINSNFFLIRILIVEYMRPSLHTVCLNICYGFFLFLGMVSTPWITILLGTWRRFMLLE
MVSIIMVPIFFYFVPESVQWLISRKKYGQAITALKRVAKINGRQIDDRVYEEFIEDCKLS
QQNAKKHPNLLDLFKTPHLRRTYLIMLFEFMVLPYYCKLLVYYVRGFKISPFVMSSLRAA
PILPASLVIIIVQDRIGRKALAMTIRFLIVLFLLLSSIFLSHAANRLLFTFFVIGIFFCN
LAFHSNMQYAIELIPTCVRGQALGAIYDVDLMYIICIKYILNTSADFLSLPEIILGVLTL
LGACLFLLLPETLNRTLPCSLEDGEKLGNDEHWYTFGCTKKRTQPEELNSLAQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgtgcttggaatatatgtaaataacacaatgttggaagtggacagaatgatg
gaacaatgcggtgatttaagtaggcagcagctaatcttgctgttactctctcctttgatc
actctactatcagccgtgcatttccgatcctattcgatccttaatactgtgccaaagtat
tggtgtgctgatgggctggagtcgggggcacgaccaccaaatgaatccagctgcaaacca
ctgtacaataatgcaacacactcaagctcctgcaaaaagtacaactatgagcattatatg
ggttatcagagttttgtcagtgaaatgaactggatatgtgatcaagaggataaacttagc
aagggagactccgtgtaccttgcgggttgcttgataggctgtctagttatgggctatttg
gctgatagattgggtcgtgtgcccattcttgttttggccaaggttgtcaccatattcggc
aactttttgacaatctttggcatgagtctggcactttattgtatatttagatttattacc
ggcttcgtaattaacagcaacttttttcttatccgaattctaattgtggaatatatgcgt
ccttctttgcacaccgtttgcctaaacatctgctacggtttctttttatttttgggcatg
gtaagcacaccttggataaccatcctcttgggtacttggcgtcgtttcatgcttctcgaa
atggtgtcaataattatggtgccgattttcttttattttgtaccggagagcgtgcaatgg
ctgatctcaaggaagaaatatggccaggctataaccgccctaaagcgtgtggccaagata
aatggccgccaaattgatgacagggtctatgaggaattcattgaagactgcaaattaagt
caacaaaatgcgaagaaacacccaaatctgcttgacctcttcaagacaccgcacctacgc
cgcacctatttaataatgttgtttgaattcatggtacttccctactactgtaaactcttg
gtttattatgtgcgtggctttaagatttcgccatttgtaatgtcctcattgcgggcagct
cctattctgcctgcttccttggtaataattatcgtgcaagatcgcataggacgtaaggcg
ttggctatgacaatacggttccttattgtccttttcctcttgctatcgagcatcttcctc
tcgcatgctgctaatcgcttactattcacgtttttcgtaattgggatttttttttgcaac
cttgccttccattcgaatatgcagtatgccattgagctgattccaacatgtgtgcgtggc
caggcattgggtgccatctatgatgtagaccttatgtacataatatgcataaaatacata
ttgaacacgtctgcagacttcttgtcgttgccggaaatcattctgggcgtgctcactctg
ctaggtgcctgcttgttcttgctgctgccggagacactgaatcgcactctgccctgctca
ctggaggatggcgagaagcttggcaatgacgagcattggtacacatttgggtgcacgaag
aagcgcacgcagccggaagagcttaatagcttggctcaataa

DBGET integrated database retrieval system