KEGG   Drosophila virilis: Dvir_GJ10790Help
Entry
Dvir_GJ10790      CDS       T01066                                 

Definition
GJ10790 gene product from transcript GJ10790-RA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dvi  Drosophila virilis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dvi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 636 aa AA seqDB search
MVSRLRLHSLAAALFVLSLQLSSVCGIIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPY
AKPPVDDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEIWNPNTNVSEDCL
YINVWAPAKARLRHGRGANGAEHSGNKQADTEHLIHNGNPQNTTNGLPILIWIYGGGFMT
GSATLDIYNADIMSAVGNVIVASFQYRVGAFGFLHLAPEMPAEFAEEAPGNVGLWDQALA
IRWIKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTKGVVKRGMMQSGTMNAPWSHM
TSAKALEIGKSLINDCNCNASMLKTNPAHVMSCMRAVDAKTISVQQWNSYSGILSFPSAP
TIDGAFLPEDPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYL
EIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHYFTCPTNEYAQALAER
GASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNSVI
EFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPKVRSWA
GSDCDSGSASTSPQMQLLGLGLVLYICAVLRIKGVF
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggtctctcggctgcgtctccattcgctggccgccgcgctcttcgtgctgtcgctgcaa
ttgtccagcgtctgcggcatcatcgatcgtttggtggtgcagaccagttccgggccggtg
cgtggccgttcggtgacggtgcagggacgtgaggtgcatgtctatacgggcataccctat
gccaagccgccagtcgatgatttgcgctttcgcaaaccggtgccggccgagccctggcac
ggcgttttggatgccacacgcctctcggccacctgcgtgcaggagcgctatgaatacttt
ccgggcttctccggtgaggagatctggaatcccaataccaatgtttctgaggactgtctg
tatataaatgtgtgggcgccggcaaaggcgcgtttgcgtcatggacgtggtgccaatgga
gccgagcactctggcaacaagcaggccgacacggagcatctcatacacaatggcaatccg
cagaacacgactaacgggctgcccatcctcatatggatctatggtgggggcttcatgacg
ggctcggccaccctggatatttacaatgccgacattatgtctgccgtgggcaatgtgatc
gttgcctcgtttcagtatcgcgtgggcgcatttggttttctacatttggcgccagaaatg
ccggcagagtttgcggaggaggcgcccggcaatgtgggcctgtgggatcaggccttggcc
atacgctggataaaggataatgcccatgcctttggcgggaatcccgagtggatgacattg
tttggcgagtccgcaggctcgagttcggtgaatgcacagctcatgtcgccggtcactaaa
ggcgtggtcaagcgcggcatgatgcagtcgggcaccatgaatgcgccctggagtcacatg
acatccgccaaggcgctcgagattggcaaatctctgatcaatgactgcaactgcaatgcc
tccatgctcaagaccaatccggctcatgtgatgagctgcatgcgcgctgtggacgccaag
accatatcggtgcagcagtggaattcctactcgggcatactcagcttcccatcggcgcca
accattgatggtgccttcttgcccgaagatcctatgacactgatgaagacggctgatcta
aaggattatgatattctcatgggcaatgtcagagatgagggcacctatttcttgctgtac
gatttcatcgattactttgataaggatgatgccaccgcgctgccacgtgacaagtatctg
gagattatgaataacatatttggcaaggcaacgcaggcggaacgcgaggccatcatattt
cagtacaccagctgggagggcaatccaggctatcaaaatcagcagcaaattggtagagct
gtgggggatcactacttcacctgccccaccaatgagtatgcacaggcgctggccgagcga
ggcgcctccgtgcattactattactttacacaccgcaccagcacatcgctgtggggcgag
tggatgggcgtgctgcacggcgatgaaattgagtatttctttgggcagccgctaaacaca
tctctgcaatatcgacctgtggagcgggagctgggcaagcgtatgctcaattcggttatt
gagtttgccaagacgggcaatccggcacaagatggcgaggaatggcccaacttttcaaag
gaggatcctgtgtattatatattcagcacagacgataaaattgagaaactggcacgtggc
ccactcgccgcgcgctgctctttctggaacgattatttgcctaaagtcaggagttgggca
ggctcggactgtgattcgggtagtgcttccacgtcgccccaaatgcagctgctgggactt
ggactggtgctctacatttgtgccgttttgcgaattaagggagttttctaa

DBGET integrated database retrieval system