KEGG   Drosophila virilis: Dvir_GJ10790Help
Entry
Dvir_GJ10790      CDS       T01066                                 

Definition
GJ10790 gene product from transcript GJ10790-RA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dvi  Drosophila virilis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dvir_GJ10790
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dvir_GJ10790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 636 aa AA seqDB search
MVSRLRLHSLAAALFVLSLQLSSVCGIIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPY
AKPPVDDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEIWNPNTNVSEDCL
YINVWAPAKARLRHGRGANGAEHSGNKQADTEHLIHNGNPQNTTNGLPILIWIYGGGFMT
GSATLDIYNADIMSAVGNVIVASFQYRVGAFGFLHLAPEMPAEFAEEAPGNVGLWDQALA
IRWIKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTKGVVKRGMMQSGTMNAPWSHM
TSAKALEIGKSLINDCNCNASMLKTNPAHVMSCMRAVDAKTISVQQWNSYSGILSFPSAP
TIDGAFLPEDPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYL
EIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHYFTCPTNEYAQALAER
GASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNTSLQYRPVERELGKRMLNSVI
EFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPKVRSWA
GSDCDSGSASTSPQMQLLGLGLVLYICAVLRIKGVF
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggtctctcggctgcgtctccattcgctggccgccgcgctcttcgtgctgtcgctgcaa
ttgtccagcgtctgcggcatcatcgatcgtttggtggtgcagaccagttccgggccggtg
cgtggccgttcggtgacggtgcagggacgtgaggtgcatgtctatacgggcataccctat
gccaagccgccagtcgatgatttgcgctttcgcaaaccggtgccggccgagccctggcac
ggcgttttggatgccacacgcctctcggccacctgcgtgcaggagcgctatgaatacttt
ccgggcttctccggtgaggagatctggaatcccaataccaatgtttctgaggactgtctg
tatataaatgtgtgggcgccggcaaaggcgcgtttgcgtcatggacgtggtgccaatgga
gccgagcactctggcaacaagcaggccgacacggagcatctcatacacaatggcaatccg
cagaacacgactaacgggctgcccatcctcatatggatctatggtgggggcttcatgacg
ggctcggccaccctggatatttacaatgccgacattatgtctgccgtgggcaatgtgatc
gttgcctcgtttcagtatcgcgtgggcgcatttggttttctacatttggcgccagaaatg
ccggcagagtttgcggaggaggcgcccggcaatgtgggcctgtgggatcaggccttggcc
atacgctggataaaggataatgcccatgcctttggcgggaatcccgagtggatgacattg
tttggcgagtccgcaggctcgagttcggtgaatgcacagctcatgtcgccggtcactaaa
ggcgtggtcaagcgcggcatgatgcagtcgggcaccatgaatgcgccctggagtcacatg
acatccgccaaggcgctcgagattggcaaatctctgatcaatgactgcaactgcaatgcc
tccatgctcaagaccaatccggctcatgtgatgagctgcatgcgcgctgtggacgccaag
accatatcggtgcagcagtggaattcctactcgggcatactcagcttcccatcggcgcca
accattgatggtgccttcttgcccgaagatcctatgacactgatgaagacggctgatcta
aaggattatgatattctcatgggcaatgtcagagatgagggcacctatttcttgctgtac
gatttcatcgattactttgataaggatgatgccaccgcgctgccacgtgacaagtatctg
gagattatgaataacatatttggcaaggcaacgcaggcggaacgcgaggccatcatattt
cagtacaccagctgggagggcaatccaggctatcaaaatcagcagcaaattggtagagct
gtgggggatcactacttcacctgccccaccaatgagtatgcacaggcgctggccgagcga
ggcgcctccgtgcattactattactttacacaccgcaccagcacatcgctgtggggcgag
tggatgggcgtgctgcacggcgatgaaattgagtatttctttgggcagccgctaaacaca
tctctgcaatatcgacctgtggagcgggagctgggcaagcgtatgctcaattcggttatt
gagtttgccaagacgggcaatccggcacaagatggcgaggaatggcccaacttttcaaag
gaggatcctgtgtattatatattcagcacagacgataaaattgagaaactggcacgtggc
ccactcgccgcgcgctgctctttctggaacgattatttgcctaaagtcaggagttgggca
ggctcggactgtgattcgggtagtgcttccacgtcgccccaaatgcagctgctgggactt
ggactggtgctctacatttgtgccgttttgcgaattaagggagttttctaa

DBGET integrated database retrieval system