KEGG   Drosophila virilis: Dvir_GJ10793Help
Entry
Dvir_GJ10793      CDS       T01066                                 

Gene name
Dvir_Uro
Definition
Urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dvi  Drosophila virilis
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dvi00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:dvi00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 342 aa AA seqDB search
MFATPLRQLSSLKRSGIAGQEQAQLYEITNKGYGKDAVKVMHINRKGPVHSIQELEVGTH
LKLYSNKDYMLGNNSDVVATDSQKNTVYLLAKKHGIESPEKFALILAKHFLSTYAHVEEV
HVHVEAYPWQRMTQDVSDNIGKGYCENNCNSRSNGNCQLHNHAFIFTPTAQHYCDVILTR
QDPKQTVISGIKGLRVLKTTQSSFVNFVDDEFRTLADQYDRIFSTVVECSWEYSDTESVN
FLHAWETVKDIVLRNFAGDPSVGIPSPSVQHTLYLSEKQVLDVLPQVSVVSMTMPNKHYF
NFDTKPFQQLVPGENNEVFIPTDKPHGTIYAQLSRKSLKSHL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaactccactgcgccaactgagcagcctgaagcgttccggcatagcgggccaa
gagcaagcgcaactgtacgagattaccaacaagggatatggcaaggatgcagtgaaagtg
atgcatatcaatcgcaagggtccggtgcacagcattcaggaattggaggtgggcacacac
ctgaagctctacagcaacaaggactatatgctgggcaacaactcggatgttgtggcgacc
gattcgcaaaagaacaccgtatatctgctagccaagaaacacggcatcgagagtcccgaa
aagtttgcactgatattagctaagcattttctgagcacatatgcgcacgtggaagaggta
catgtccatgtagaagcgtatccttggcagcgcatgacccaggatgtttccgataatatc
ggcaaagggtactgcgagaacaactgtaattccagatcgaatggcaattgtcagctgcac
aaccacgcctttatcttcacacccacggcgcagcattactgcgacgtgatcctgacgcgt
caagatcccaagcagactgtcatcagtggcatcaaaggactgcgcgttctgaagacgaca
caatcatcatttgtgaactttgttgacgatgagttccgcacgctggcggatcagtatgat
cgcatctttagcaccgttgtggagtgctcctgggagtactcggatacggagtcggtcaac
tttttgcacgcctgggagactgtcaaggatatagtgcttcgcaactttgccggtgatcca
agtgtgggcatcccctcgccctcagtgcagcacacactgtatctcagtgagaaacaggtt
ctggacgtattgccacaggtgtccgtcgtctcaatgacaatgcccaataagcactatttc
aatttcgatacaaaaccatttcaacaattggtgccaggggagaacaatgaggtcttcata
ccgaccgacaagccacatggcaccatctatgctcaactctcacgtaaaagtctcaaaagc
catctctaa

DBGET integrated database retrieval system