KEGG   Drosophila virilis: Dvir_GJ10793Help
Entry
Dvir_GJ10793      CDS       T01066                                 

Gene name
Dvir_Uro
Definition
Urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dvi  Drosophila virilis
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dvir_GJ10793 (Dvir_Uro)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Dvir_GJ10793 (Dvir_Uro)
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Dvir_GJ10793 (Dvir_Uro)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 342 aa AA seqDB search
MFATPLRQLSSLKRSGIAGQEQAQLYEITNKGYGKDAVKVMHINRKGPVHSIQELEVGTH
LKLYSNKDYMLGNNSDVVATDSQKNTVYLLAKKHGIESPEKFALILAKHFLSTYAHVEEV
HVHVEAYPWQRMTQDVSDNIGKGYCENNCNSRSNGNCQLHNHAFIFTPTAQHYCDVILTR
QDPKQTVISGIKGLRVLKTTQSSFVNFVDDEFRTLADQYDRIFSTVVECSWEYSDTESVN
FLHAWETVKDIVLRNFAGDPSVGIPSPSVQHTLYLSEKQVLDVLPQVSVVSMTMPNKHYF
NFDTKPFQQLVPGENNEVFIPTDKPHGTIYAQLSRKSLKSHL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaactccactgcgccaactgagcagcctgaagcgttccggcatagcgggccaa
gagcaagcgcaactgtacgagattaccaacaagggatatggcaaggatgcagtgaaagtg
atgcatatcaatcgcaagggtccggtgcacagcattcaggaattggaggtgggcacacac
ctgaagctctacagcaacaaggactatatgctgggcaacaactcggatgttgtggcgacc
gattcgcaaaagaacaccgtatatctgctagccaagaaacacggcatcgagagtcccgaa
aagtttgcactgatattagctaagcattttctgagcacatatgcgcacgtggaagaggta
catgtccatgtagaagcgtatccttggcagcgcatgacccaggatgtttccgataatatc
ggcaaagggtactgcgagaacaactgtaattccagatcgaatggcaattgtcagctgcac
aaccacgcctttatcttcacacccacggcgcagcattactgcgacgtgatcctgacgcgt
caagatcccaagcagactgtcatcagtggcatcaaaggactgcgcgttctgaagacgaca
caatcatcatttgtgaactttgttgacgatgagttccgcacgctggcggatcagtatgat
cgcatctttagcaccgttgtggagtgctcctgggagtactcggatacggagtcggtcaac
tttttgcacgcctgggagactgtcaaggatatagtgcttcgcaactttgccggtgatcca
agtgtgggcatcccctcgccctcagtgcagcacacactgtatctcagtgagaaacaggtt
ctggacgtattgccacaggtgtccgtcgtctcaatgacaatgcccaataagcactatttc
aatttcgatacaaaaccatttcaacaattggtgccaggggagaacaatgaggtcttcata
ccgaccgacaagccacatggcaccatctatgctcaactctcacgtaaaagtctcaaaagc
catctctaa

DBGET integrated database retrieval system