KEGG   Drosophila virilis: Dvir_GJ10797Help
Entry
Dvir_GJ10797      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17610  calcineurin B homologous protein 1
Organism
dvi  Drosophila virilis
Brite
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dvir_GJ10797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 6632540
NCBI-ProteinID: XP_002056183
FlyBase: FBgn0198068
UniProt: B4M6L9
Position
Unknown
AA seq 238 aa AA seqDB search
MHCSWQCCIIISLNISILALAKLGHTTLRSIQWKFCVCVALIGLNKPQIMGNKSSLFLRH
EEIAQIQNETGFTPNQIERLYSRFTSLDRNGCGTLSREDLMRIPELAINPLCERIVHSFF
AESTDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLS
ILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcagttggcagtgctgcatcattatctctttgaatatcagtattttagcactt
gccaaactcggtcacactacgctccgttcaattcagtggaaattttgtgtttgtgtagct
ctcattggtttaaataagccacaaataatgggcaataagtcatcgctctttctgcggcac
gaggaaattgcccaaatacagaatgaaacaggctttacacccaatcaaattgagcgcctg
tattcgcgtttcacctcgctggatcgcaacggctgcggcacactatcgcgagaggatctg
atgcgcatacccgaactagccatcaatccgctctgcgagcgcattgtccactccttcttt
gcggagagcaccgatgatcgggtcaactttcgccagtttatgaatgtgttggcccacttc
cggccgctgcgggacaacaagcagagcaaactgaacagccgcgaggagaagcttaagttt
gcattcaaaatgtacgatctggacgatgatggtgtcattagccgggatgagctgctgtcg
atattgcacatgatggttggcgcgaacataagtcaggatcagttggtgagcattgcggaa
cggacaatactggaggcggatctgtgctgtcagggcaagatctcgttcgaggacttttgc
aaggcgctggatcgcaccgatgtcgatcagaagatgtccatacggtttcttaattag

DBGET integrated database retrieval system