KEGG   Drosophila virilis: Dvir_GJ10887Help
Entry
Dvir_GJ10887      CDS       T01066                                 

Definition
(RefSeq) GJ10887 gene product from transcript GJ10887-RB
  KO
K14316  
nuclear pore complex protein Nup121
Organism
dvi  Drosophila virilis
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ10887
Messenger RNA biogenesis [BR:dvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dvir_GJ10887
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1031 aa AA seqDB search
MERRYSLSNSPRLSKPMADSTWIDGMPARQRTAAQQLHTNLGSRERSNSSICLSNSYTNG
SPQHRSLHQLSRTSTSVSKMTRQRLNLSQLDPKTFADVHSSGLASRIVEYQRESGRGLQR
SISFNNVYNPFTQPRRSSIAVSPLCHKPSLPSVSMTRIAPPERSFYCGNTLPSLLRSNSL
LGVEKVSDQLSRENRPIMHPPPLQHESEPTRSVLEELKEISRKRINSGEIQPNEYNSKKS
CNRMADYVDHHHQQQQQHHRQHHQQHHQQQHHQQHHQQFHPHHQMSMLQPQSGFKRQREL
TVSVPLRLHHPPIALPQHQHPHQALHMPAHHFAASVSPQQSPEQLAKRRNCSYSNDIASS
LSSSKLHSNKRKLYDKRATSNTSTNNANASSGSNSSGSSETSPRQQAAKIQRNQQPSTVD
LRLEHLSRTQSTPITALPVTAAQRTVSAPVVQTRHEPAKPKLTLFNAQQRQQQQQERQLE
QDLDSPDVDANEYAGIQFVKPKQQHTLGASKNSHLERTQKTKLALMLSSLRGEIYQDETA
ADEADAMPVKATVAAAPATTTATVTGVTTTTTTTKPTSSEPSKIFSFGNNTTTPAATPIF
GSASASAATPIFGSGPAATTTPIFGSAAASTATPVFGSATATTAQPAFSFGGAATPAAAA
ETAAPSAANSSNLFAFGGANKPVAKATPFTLPNKASSNGGSSVFSFGGGNGDGPKMGATA
TTAGSAPSAANSFSFNSTTATAAAPAAATNTFSFNATAKQTPIFGSNNATESKPFAFGGN
AGAQQQDQQPQQTTSATAAAGAQTQQQQQAGGFSFAAVAQKSETTNLFSSPAASTGVVKP
SFNFGGNTGPSTASGAAGTASAPANGLGAFAAPAQPANSPPNLFTFGGNATTNNAPTAGG
NLFANAVAAAQNHQQQAKPGGFSFSANNSNNAAAPAGNANTPFAFGGITSTPQSSNVAKP
FTFGNPTASNIFGSPSTTAAATNGGANNFGGAATPTSAPGMPGTPQQMNPFAPPSTPESR
PIRRATRRLKK
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgttatagtttgagcaactcgccgcgcttatcaaaacccatggcggattcc
acatggattgatggcatgcccgccagacagcgaacggcggcgcagcaacttcacacaaat
ttaggttcaagggagcgcagtaattcgagcatttgtttaagtaatagctacacaaatggt
tcaccgcagcacagaagcctgcatcagctatcaaggacatctacgagcgtgtccaaaatg
actcgtcaaaggcttaatctcagccagttggatcccaaaacctttgcggacgtgcatagc
agcggcctagcctcgcgcattgttgaataccagcgggagagtggccgtggcttgcagcgc
agcatatcctttaacaatgtttacaatccgtttacacagccgcgacgttccagcattgca
gtgtcaccactctgccataagcccagcttgccgtcggtgtccatgacacgcatagcgccg
cccgagcgcagcttttactgtggcaacacattgcccagccttttacgttccaattcgctg
ctgggcgtggagaaggtcagcgatcagttgtcgcgcgaaaatcgccccatcatgcatccg
ccgccgttgcagcacgaaagcgaaccgacgcgtagcgtcttggaggagctgaaggagatt
tcgcgcaagcgcatcaacagcggcgaaattcaacccaacgaatataatagcaaaaagagc
tgcaatcgcatggctgattacgtggatcatcatcatcaacagcagcagcagcatcatcgg
caacatcatcagcaacatcatcagcaacagcatcaccagcagcatcaccagcagtttcat
cctcatcatcagatgtccatgttgcagccacagtctggttttaagcgacagcgtgaactg
accgtttcggtgcctctacgtttgcatcatccgcctatagctctgccacagcatcagcat
ccacatcaggccttacacatgccggcacatcattttgccgccagcgtttcgccacagcag
tcaccggaacagctagccaagcgtcgcaattgcagctatagcaatgacattgccagctcc
cttagctctagcaagctacacagcaacaagcgcaagctgtacgataagcgcgcaaccagc
aacacgtccacaaacaatgccaatgccagcagtggcagcaacagcagcggctcatcggaa
acttcgccccgccaacaggcggccaaaatacagcgcaatcagcaaccttccacagttgat
ttgcgtctagagcatttgtctaggacacagagcacgcccataaccgcgctgccggtgaca
gcagcccagcgcacagtctcggctcccgtagtgcagacccggcacgagccagccaaaccc
aaactgacgctgttcaatgcacaacaacgacaacagcagcaacaggaacggcagttagaa
caggatctggatagtcctgatgtggacgccaacgaatatgcgggcatacagtttgtcaag
cccaagcagcagcatacgttgggcgcaagcaaaaactctcatctggagcgcacacaaaag
acaaaactggctttaatgttgagtagcctgcgcggtgaaatctatcaggatgaaacggcg
gcggatgaggcagatgcaatgccagtgaaggcaactgtggcagcagcaccagcaacaaca
acagccacagtaacaggtgtaacaacaaccacaacaacgacaaagccaacatcttccgag
ccgtctaagatatttagttttggcaacaacacaacaacaccagcagctacgccaatattt
ggtagtgcatcagcctcagcagctacgccaatatttggcagtggaccagctgcaacaact
acgccaatatttggtagtgccgcagcctcaacagctacgcccgtatttggcagtgcaaca
gcaacaacggcacagcccgctttcagttttggcggtgcagcaactccagcagcagcagcg
gagacagctgccccgtccgcagcaaacagctcgaatctatttgcatttggtggtgctaac
aagcccgtggcaaaggcaacgccctttacactgcccaacaaagccagcagcaacggcggc
agcagcgtgttcagctttggcggcggcaacggtgatggacccaaaatgggagcaacagca
acaacagccggatcagcgccttcagcagcgaacagtttcagttttaatagcacaactgca
actgccgctgcaccagcagcggccacaaacacgttcagtttcaatgcaactgccaagcag
acgcccatattcggcagcaacaatgcaacagaatccaagccgtttgcatttgggggaaat
gctggcgctcaacagcaggatcagcagccgcaacagacgacatcagcaacagcagcagct
ggagcacaaacacagcaacagcaacaagcgggcggcttttcctttgccgcggtggctcaa
aagagcgaaaccacaaatttattcagctcaccggcggccagcaccggcgttgttaagcct
agttttaattttggcggcaacacagggccatcaacggcttctggagcagcaggaacagca
tctgcgccagccaatggccttggtgcatttgcggcaccagcacaaccagccaacagccct
ccaaatttgtttacatttggcggcaacgctacgaccaataatgctccaacggctggcggc
aatctttttgccaacgctgtggccgccgcacagaatcatcagcaacaggccaagccgggc
ggtttctccttcagcgcgaacaacagcaacaatgctgctgccccagcaggcaatgcaaat
acaccgtttgcctttggcggcatcacgtccacgccgcagagcagcaatgtggccaaacca
tttacctttggcaatccaacagcctcaaatatctttggcagcccatcgacgacggcggca
gctactaacggcggggccaacaattttggcggtgccgccacaccgacttcagcacctggc
atgcctggtacgccgcagcagatgaatccattcgcaccgcccagcacgcccgagagtcga
cccatacgacgtgccacacgacgcctgaaaaagtag

DBGET integrated database retrieval system