KEGG   Drosophila virilis: Dvir_GJ10887Help
Entry
Dvir_GJ10887      CDS       T01066                                 

Definition
GJ10887 gene product from transcript GJ10887-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dvi  Drosophila virilis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ10887
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1366 aa AA seqDB search
MERRYSLSNSPRLSKPMADSTWIDGMPAQRTAAQQLHTNLGSRERSNSSICLSNSYTNGS
PQHRSLHQLSRTSTSVSKMTRQRLNLSQLDPKTFADVHSSGLASRIVEYQRESGRGLQRS
ISFNNVYNPFTQPRRSSIAVSPLCHKPSLPSVSMTRIAPPERSFYCGNTLPSLLRSNSLL
GVEKVSDQLSRENRPIMHPPPLQHESEPTRSVLEELKEISRKRINSGEIQPNEYNSKKSC
NRMADYVDHHHQQQQQHHRQHHQQHHQQQHHQQHHQQFHPHHQMSMLQPQSGFKRQRELT
VSVPLRLHHPPIALPQHQHPHQALHMPAHHFAASVSPQQSPEQLAKRRNCSYSNDIASSL
SSSKLHSNKRKLYDKRATSNTSTNNANASSGSNSSGSSETSPRQQAAKIQRNQQPSTVDL
RLEHLSRTQSTPITALPVTAAQRTVSAPVVQTRHEPAKPKLTLFNAQQRQQQQQERQLEQ
DLDSPDVDANEYAGIQFVKPKQQHTLGASKNSHLERTQKTKLALMLSSLRGEIYQDETAA
DEADAMPVKATVAAAPATTTATVTGVTTTTTTTKPTILATTAPALTPITASPKAAETKTT
AVETTTATTTESETATTVATNVSNSTLPLLSFNNATPNVSQDLTAVGVSIPGLTLPTSTG
KPITTVAATTATSTPTIMSSAATTTTAGAATVAPVLTFGKSVTAEAGAATVLPAFTFGKP
AAAAAVAEGAPPTTTAAPATTMFAFGNPAIATTASSAPATAAAPAATVLAAASSGAAEAV
KSTPMFSFGKPAATATANSTPFAIAAATTTTTTVASAPVFSFGKAATTAATTEPAAEAAT
ATTSKPFTFGNSSSSNNTAAATVATAAPGVKLDNWPSQPVEPNALSSSFGNAFQPAATTA
SAATPAAAAAATSSEPSKIFSFGNNTTTPAATPIFGSASASAATPIFGSGPAATTTPIFG
SAAASTATPVFGSATATTAQPAFSFGGAATPAAAAETAAPSAANSSNLFAFGGANKPVAK
ATPFTLPNKASSNGGSSVFSFGGGNGDGPKMGATATTAGSAPSAANSFSFNSTTATAAAP
AAATNTFSFNATAKQTPIFGSNNATESKPFAFGGNAGAQQQDQQPQQTTSATAAAGAQTQ
QQQQAGGFSFAAVAQKSETTNLFSSPAASTGVVKPSFNFGGNTGPSTASGAAGTASAPAN
GLGAFAAPAQPANSPPNLFTFGGNATTNNAPTAGGNLFANAVAAAQNHQQQAKPGGFSFS
ANNSNNAAAPAGNANTPFAFGGITSTPQSSNVAKPFTFGNPTASNIFGSPSTTAAATNGG
ANNFGGAATPTSAPGMPGTPQQMNPFAPPSTPESRPIRRATRRLKK
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgttatagtttgagcaactcgccgcgcttatcaaaacccatggcggattcc
acatggattgatggcatgcccgcacagcgaacggcggcgcagcaacttcacacaaattta
ggttcaagggagcgcagtaattcgagcatttgtttaagtaatagctacacaaatggttca
ccgcagcacagaagcctgcatcagctatcaaggacatctacgagcgtgtccaaaatgact
cgtcaaaggcttaatctcagccagttggatcccaaaacctttgcggacgtgcatagcagc
ggcctagcctcgcgcattgttgaataccagcgggagagtggccgtggcttgcagcgcagc
atatcctttaacaatgtttacaatccgtttacacagccgcgacgttccagcattgcagtg
tcaccactctgccataagcccagcttgccgtcggtgtccatgacacgcatagcgccgccc
gagcgcagcttttactgtggcaacacattgcccagccttttacgttccaattcgctgctg
ggcgtggagaaggtcagcgatcagttgtcgcgcgaaaatcgccccatcatgcatccgccg
ccgttgcagcacgaaagcgaaccgacgcgtagcgtcttggaggagctgaaggagatttcg
cgcaagcgcatcaacagcggcgaaattcaacccaacgaatataatagcaaaaagagctgc
aatcgcatggctgattacgtggatcatcatcatcaacagcagcagcagcatcatcggcaa
catcatcagcaacatcatcagcaacagcatcaccagcagcatcaccagcagtttcatcct
catcatcagatgtccatgttgcagccacagtctggttttaagcgacagcgtgaactgacc
gtttcggtgcctctacgtttgcatcatccgcctatagctctgccacagcatcagcatcca
catcaggccttacacatgccggcacatcattttgccgccagcgtttcgccacagcagtca
ccggaacagctagccaagcgtcgcaattgcagctatagcaatgacattgccagctccctt
agctctagcaagctacacagcaacaagcgcaagctgtacgataagcgcgcaaccagcaac
acgtccacaaacaatgccaatgccagcagtggcagcaacagcagcggctcatcggaaact
tcgccccgccaacaggcggccaaaatacagcgcaatcagcaaccttccacagttgatttg
cgtctagagcatttgtctaggacacagagcacgcccataaccgcgctgccggtgacagca
gcccagcgcacagtctcggctcccgtagtgcagacccggcacgagccagccaaacccaaa
ctgacgctgttcaatgcacaacaacgacaacagcagcaacaggaacggcagttagaacag
gatctggatagtcctgatgtggacgccaacgaatatgcgggcatacagtttgtcaagccc
aagcagcagcatacgttgggcgcaagcaaaaactctcatctggagcgcacacaaaagaca
aaactggctttaatgttgagtagcctgcgcggtgaaatctatcaggatgaaacggcggcg
gatgaggcagatgcaatgccagtgaaggcaactgtggcagcagcaccagcaacaacaaca
gccacagtaacaggtgtaacaacaaccacaacaacgacaaagccaactatacttgcgacg
actgctccggcgttaacgccaataacagcttctcctaaagcagccgagacaaaaacaaca
gcagttgaaacaacaacagcaacaacaacagaatcagaaacagcaacaactgtagcaaca
aatgtcagcaacagcacgttgcctttgctgtcatttaacaacgcgacacctaatgtcagc
caagacttaacagctgtaggagtttctattcctggccttacactaccgacatcaacaggc
aaaccaataacaactgtagcagctacaacagcaacatcaactcctacaattatgagttcg
gcggcaacaacaacaacagcaggagcagcaactgttgcgcctgttctgacgtttggcaag
tctgtaactgcagaggcaggagctgcgactgtgctgcctgcttttacatttggcaagcca
gcagcggcagcagcagtagcagagggagcaccaccaacaacaacagcagcaccagcaaca
accatgtttgcctttggcaacccagcaatcgctacaactgcaagcagtgcacctgcaacg
gcagcagcaccagcagcaacagtactagcagcagcatcatcgggagcagcagaagcagta
aaaagcacacctatgtttagttttggtaagcccgcagctactgcaacagcaaacagcacg
ccatttgcaatagctgcagccacaaccacgaccactacagtcgcaagcgctccagtattt
agttttggaaaagctgcaaccactgcggcaacaacagaaccagcagcggaagcagcgaca
gcaacaaccagtaaaccattcacatttggcaacagcagcagcagcaataatactgcagca
gcaactgttgcaacagctgcgcctggtgtcaagcttgataactggccgtctcagcccgtg
gaaccgaacgcccttagcagcagctttggcaatgctttccagccagctgcaacaacggca
tctgcagccacaccagcagcagcagcggcagcaacatcttccgagccgtctaagatattt
agttttggcaacaacacaacaacaccagcagctacgccaatatttggtagtgcatcagcc
tcagcagctacgccaatatttggcagtggaccagctgcaacaactacgccaatatttggt
agtgccgcagcctcaacagctacgcccgtatttggcagtgcaacagcaacaacggcacag
cccgctttcagttttggcggtgcagcaactccagcagcagcagcggagacagctgccccg
tccgcagcaaacagctcgaatctatttgcatttggtggtgctaacaagcccgtggcaaag
gcaacgccctttacactgcccaacaaagccagcagcaacggcggcagcagcgtgttcagc
tttggcggcggcaacggtgatggacccaaaatgggagcaacagcaacaacagccggatca
gcgccttcagcagcgaacagtttcagttttaatagcacaactgcaactgccgctgcacca
gcagcggccacaaacacgttcagtttcaatgcaactgccaagcagacgcccatattcggc
agcaacaatgcaacagaatccaagccgtttgcatttgggggaaatgctggcgctcaacag
caggatcagcagccgcaacagacgacatcagcaacagcagcagctggagcacaaacacag
caacagcaacaagcgggcggcttttcctttgccgcggtggctcaaaagagcgaaaccaca
aatttattcagctcaccggcggccagcaccggcgttgttaagcctagttttaattttggc
ggcaacacagggccatcaacggcttctggagcagcaggaacagcatctgcgccagccaat
ggccttggtgcatttgcggcaccagcacaaccagccaacagccctccaaatttgtttaca
tttggcggcaacgctacgaccaataatgctccaacggctggcggcaatctttttgccaac
gctgtggccgccgcacagaatcatcagcaacaggccaagccgggcggtttctccttcagc
gcgaacaacagcaacaatgctgctgccccagcaggcaatgcaaatacaccgtttgccttt
ggcggcatcacgtccacgccgcagagcagcaatgtggccaaaccatttacctttggcaat
ccaacagcctcaaatatctttggcagcccatcgacgacggcggcagctactaacggcggg
gccaacaattttggcggtgccgccacaccgacttcagcacctggcatgcctggtacgccg
cagcagatgaatccattcgcaccgcccagcacgcccgagagtcgacccatacgacgtgcc
acacgacgcctgaaaaagtag

DBGET integrated database retrieval system