KEGG   Drosophila virilis: Dvir_GJ11038Help
Entry
Dvir_GJ11038      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dvi  Drosophila virilis
Pathway
dvi04013  MAPK signaling pathway - fly
Module
dvi_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ11038
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dvir_GJ11038
Protein kinases [BR:dvi01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dvir_GJ11038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6633159
NCBI-ProteinID: XP_002056608
FlyBase: FBgn0198304
UniProt: B4M509
Position
Unknown
AA seq 431 aa AA seqDB search
MAERPKNLFATGPSRSRIPPDQLNLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQQNNVAL
RFSAQPSFVPAVPVPTAHSSSSSSNSNASAGTSGSATDRHRERIRQQACGKLQFGEGAIN
THQFTSDDLEDLGEIGRGAFGAVNKMIFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVM
KSNECIYIVQFYGALFKEGDCWICMELMDTSLDKFYKYIFEKKQRHIPESILAKITVATV
NALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPE
RIDPERAKGYDVRSDVWSLGITLMEVATGTFPYRKWDSVFEQLCQVVQGDPPRLHTSYNG
IEFSMEFAEFVHTCLIKKESDRPKYSRLLQMPFIRRGENSHTDVAAYVADVLESMESDGI
TQFTTNQPAES
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaggcccaaaaatttgtttgcaactggaccgagccgttctcgcataccgcct
gatcagcttaatctgaacaatctgagcatacgacatccgccttcatcaacgtcgtccaca
tcgtcgggatccacgtcgtcgggctccagttcctcatcgcagcagaataatgtggcttta
cgctttagcgcccagcccagctttgtgccagctgtgccggtgcccacagcccacagcagc
agtagcagcagcaatagtaatgccagcgccggcaccagcggcagcgcaacggatcggcat
agggagcgcatccgacagcaggcatgtggcaaactacagtttggtgaaggtgccatcaat
acacatcagtttacatcggacgatttggaagatttgggcgagattggacgcggtgcattt
ggtgcggtcaataaaatgatattcaagaagttggacaaggtgatggctgtgaagcgcata
cgttccacggtggacgagaaagagcagaaacagttgctcatggatttggaggtggtcatg
aagtcgaacgaatgcatctacattgttcagttctatggggcgctcttcaaggagggcgat
tgctggatatgcatggagctaatggacacctcgctggacaaattctataaatacatattc
gagaagaagcagcggcatatacccgagtccatactcgccaagatcactgtggccacagtc
aatgcgcttaactatttgaaggaggagctcaaaataatacatcgcgatgttaagccaagc
aacattctgttgcacagacgcggcgacattaaactatgtgattttggcatctccggacag
ctagtcgattcgatagccaagaccaaagatgcgggctgcaggccctacatggcgccggaa
cgcattgatccggagcgcgccaagggctatgatgtgcgcagcgatgtttggtcattgggc
ataacattaatggaggtggccacaggcacgtttccctatcgcaaatgggattcggtattt
gagcagctgtgccaggtagtgcaaggggatccgccgcgcttgcatacatcctataatggc
attgagttctccatggagttcgcagagtttgtccatacttgcttgatcaagaaggagagc
gataggcccaaatatagccgactgctgcagatgccattcatacggaggggcgagaacagc
cacacggatgtcgccgcctatgtggccgatgtgctcgagtccatggagagcgatggcatt
acgcagtttacaaccaaccagcccgcggaaagttaa

DBGET integrated database retrieval system