KEGG   Drosophila virilis: Dvir_GJ11038Help
Entry
Dvir_GJ11038      CDS       T01066                                 

Definition
GJ11038 gene product from transcript GJ11038-RA
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dvir_GJ11038
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dvir_GJ11038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 431 aa AA seqDB search
MAERPKNLFATGPSRSRIPPDQLNLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQQNNVAL
RFSAQPSFVPAVPVPTAHSSSSSSNSNASAGTSGSATDRHRERIRQQACGKLQFGEGAIN
THQFTSDDLEDLGEIGRGAFGAVNKMIFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVM
KSNECIYIVQFYGALFKEGDCWICMELMDTSLDKFYKYIFEKKQRHIPESILAKITVATV
NALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPE
RIDPERAKGYDVRSDVWSLGITLMEVATGTFPYRKWDSVFEQLCQVVQGDPPRLHTSYNG
IEFSMEFAEFVHTCLIKKESDRPKYSRLLQMPFIRRGENSHTDVAAYVADVLESMESDGI
TQFTTNQPAES
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaggcccaaaaatttgtttgcaactggaccgagccgttctcgcataccgcct
gatcagcttaatctgaacaatctgagcatacgacatccgccttcatcaacgtcgtccaca
tcgtcgggatccacgtcgtcgggctccagttcctcatcgcagcagaataatgtggcttta
cgctttagcgcccagcccagctttgtgccagctgtgccggtgcccacagcccacagcagc
agtagcagcagcaatagtaatgccagcgccggcaccagcggcagcgcaacggatcggcat
agggagcgcatccgacagcaggcatgtggcaaactacagtttggtgaaggtgccatcaat
acacatcagtttacatcggacgatttggaagatttgggcgagattggacgcggtgcattt
ggtgcggtcaataaaatgatattcaagaagttggacaaggtgatggctgtgaagcgcata
cgttccacggtggacgagaaagagcagaaacagttgctcatggatttggaggtggtcatg
aagtcgaacgaatgcatctacattgttcagttctatggggcgctcttcaaggagggcgat
tgctggatatgcatggagctaatggacacctcgctggacaaattctataaatacatattc
gagaagaagcagcggcatatacccgagtccatactcgccaagatcactgtggccacagtc
aatgcgcttaactatttgaaggaggagctcaaaataatacatcgcgatgttaagccaagc
aacattctgttgcacagacgcggcgacattaaactatgtgattttggcatctccggacag
ctagtcgattcgatagccaagaccaaagatgcgggctgcaggccctacatggcgccggaa
cgcattgatccggagcgcgccaagggctatgatgtgcgcagcgatgtttggtcattgggc
ataacattaatggaggtggccacaggcacgtttccctatcgcaaatgggattcggtattt
gagcagctgtgccaggtagtgcaaggggatccgccgcgcttgcatacatcctataatggc
attgagttctccatggagttcgcagagtttgtccatacttgcttgatcaagaaggagagc
gataggcccaaatatagccgactgctgcagatgccattcatacggaggggcgagaacagc
cacacggatgtcgccgcctatgtggccgatgtgctcgagtccatggagagcgatggcatt
acgcagtttacaaccaaccagcccgcggaaagttaa

DBGET integrated database retrieval system